SecReT4
Protein ID: 251788093
T4SS name [ID]Tfc [689]
Gene symbol-
Locus tagDd1591_0448
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T4SS(s) in this replicon]
Location [Strand]513273..515432 [-]
Producthypothetical protein
Component typeTfc6
UniProt IDC6CI89
KEGG IDdze:Dd1591_0448
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 5.8e-15, Aligned region: 507..637
TrwB_AAD_bind [PF10412], Evalue: 4.5e-10, Aligned region: 508..648
AAA_10 [PF12846], Evalue: 1.3e-06, Aligned region: 191..585
Protein Sequence: 719 a.a.     [Download]
>gi|251788093|ref|YP_003002814.1| hypothetical protein Dd1591_0448 [Dickeya zeae Ech1591]
MAKSQPVEVLLRPAVELYTVAVCAGAVLLCLTAPWSLALSPDIGIGSALAFVVFGALRWRDAQVILHYRR
NIRRLPRYVMTSRDVPVSGQRLFIGRGFLWEQKHTHRLMQTYRPEFRRYVEPTPAYQLARRLEERLEFAP
FPLSQLPRITTWDVPFNPVRPQPPVGGLPRLHGIEPDEVDVSLPLGERVGHSLVLGTTRVGKTRLAELFI
TQDIRRKNHLGEHEVVIVFDPKGDADLLKRMCVEAKRAGRENEFYVFHLGWPEISARYNAVGRFGRISEV
ATRVAGQLSREGNSAAFREFAWRFVNVIARALIELGQRPDYLLIQRHVINIDALFIEYAQHYFARTEPKA
WEVIVQIEARLNENNIPRNMIGREKRVVALEQYLSQARNYDPVLDGLRSAVRYDKTYFDKIVASLLPLLE
KLTSGKIVQLLAPNYSDLSDPRPIFDWLQIIRKRAIVYVGLDALSDAEVAAAVGNSMFSDMVSVAGHIYK
FGIDDGLPGASADTKVPINVHADEFNELMGDEFIPMVNKGGGAGIQITAYTQTLSDIEARIGNRAKAGLV
VGNFNNLFMLRVRETATAELLTKQLPKVEVYTTTVASSVTDSSDIHAKTDFTSNTQDRISLSSVPMIEPS
HVVQLPKGQCFALLQGGNLWKVRMPLPSPDPDEVMPTDLQQLAGYMRQSYTDAGQWWQNQGTPVLQEQVL
PPELLDENLDSTADQGRAP
 
Nucleotide Sequence: 2160 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c515432-513273 Dickeya zeae Ech1591 chromosome, complete genome
ATGGCAAAGTCCCAACCGGTCGAGGTACTGCTGCGTCCAGCAGTGGAACTCTATACCGTTGCGGTTTGCG
CCGGGGCAGTACTGCTGTGCCTGACAGCTCCGTGGTCTCTCGCGCTAAGTCCAGACATCGGTATCGGCAG
CGCACTGGCCTTCGTCGTCTTTGGCGCACTGCGCTGGCGTGATGCACAGGTGATCCTGCATTACCGCCGT
AATATCCGTCGCCTGCCACGCTATGTGATGACCAGCCGTGACGTGCCCGTCAGTGGACAACGACTGTTTA
TCGGTAGGGGGTTTCTGTGGGAGCAAAAGCACACCCACCGGTTGATGCAAACCTACCGACCTGAGTTCAG
GCGTTATGTAGAACCGACACCCGCCTACCAGTTGGCCCGACGTCTGGAGGAGCGGCTGGAATTCGCACCA
TTTCCGTTGTCACAATTGCCCCGTATCACCACCTGGGATGTACCGTTCAACCCGGTTCGGCCTCAGCCTC
CTGTCGGCGGACTGCCGCGACTACACGGTATCGAGCCTGATGAGGTGGATGTTAGCCTGCCCTTGGGCGA
GCGCGTCGGCCATTCTCTAGTATTGGGCACCACGCGAGTGGGTAAAACGCGGCTGGCCGAATTATTCATC
ACCCAGGACATTCGCCGAAAGAATCACCTCGGCGAGCATGAAGTGGTTATTGTTTTCGATCCTAAAGGTG
ACGCGGATCTGCTCAAGAGGATGTGCGTCGAGGCAAAACGCGCAGGCAGAGAAAACGAGTTCTATGTGTT
CCATCTTGGGTGGCCGGAGATCAGCGCACGTTACAATGCGGTGGGGCGTTTTGGTCGTATCAGCGAAGTC
GCCACCCGCGTCGCAGGACAGCTTTCCAGGGAAGGCAACTCGGCGGCCTTCAGGGAATTCGCCTGGAGAT
TTGTCAATGTCATCGCCAGGGCGTTGATCGAACTGGGTCAGCGCCCGGACTACCTGCTCATCCAACGCCA
CGTCATCAATATCGATGCGTTGTTCATCGAGTACGCCCAGCACTACTTCGCCCGCACAGAACCGAAAGCC
TGGGAGGTCATTGTCCAGATCGAAGCCAGGCTCAACGAGAATAACATTCCCAGAAATATGATCGGCCGCG
AAAAGCGTGTGGTCGCCCTTGAGCAATACCTCAGCCAGGCCCGTAACTACGATCCCGTACTGGATGGCTT
GAGATCCGCTGTTCGCTACGACAAAACGTACTTCGACAAGATCGTCGCCAGCCTGCTACCCCTGCTTGAA
AAACTCACCAGCGGTAAAATCGTCCAATTGCTGGCTCCAAACTATTCGGATCTGAGCGATCCCAGACCGA
TTTTCGATTGGCTGCAAATCATCAGGAAACGCGCAATAGTCTATGTCGGTCTTGATGCACTATCCGATGC
AGAAGTCGCAGCAGCAGTAGGCAACTCGATGTTCAGCGATATGGTCTCTGTGGCCGGACACATCTATAAA
TTCGGTATCGACGACGGTCTGCCGGGTGCATCTGCTGACACCAAGGTGCCAATCAACGTCCATGCCGATG
AATTCAATGAACTGATGGGCGATGAGTTCATCCCTATGGTCAACAAAGGGGGAGGCGCTGGCATCCAGAT
CACCGCCTATACTCAAACCCTCAGTGATATTGAAGCCCGCATAGGCAATCGCGCCAAAGCCGGCCTGGTC
GTCGGCAATTTCAACAATCTGTTCATGTTACGCGTGCGCGAAACAGCCACCGCTGAGCTACTCACGAAAC
AGTTACCCAAGGTAGAGGTCTACACCACCACTGTGGCCAGCAGCGTGACAGACAGCTCCGACATCCACGC
AAAAACCGACTTCACCAGCAACACACAGGATCGCATCAGTCTATCGAGCGTGCCGATGATTGAACCGTCC
CATGTGGTTCAACTTCCGAAAGGGCAGTGCTTCGCGCTGCTGCAGGGTGGCAATCTCTGGAAAGTCCGCA
TGCCACTGCCCTCCCCTGACCCGGATGAAGTCATGCCGACCGATCTGCAGCAATTGGCAGGCTACATGCG
CCAGAGCTACACCGATGCCGGGCAATGGTGGCAGAACCAGGGGACCCCCGTGTTGCAGGAGCAAGTACTG
CCACCTGAGCTGCTCGATGAAAACCTCGACAGCACCGCCGACCAGGGTAGAGCACCATGA
 Primer design