SecReT4
Protein ID: 251788094
T4SS name [ID]Tfc [689]
Gene symbol-
Locus tagDd1591_0449
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T4SS(s) in this replicon]
Location [Strand]515437..515979 [-]
Producthypothetical protein
Component typeTfc5
UniProt IDC6CI90
KEGG IDdze:Dd1591_0449
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 1.4e-49, Aligned region: 32..179
Protein Sequence: 180 a.a.     [Download]
>gi|251788094|ref|YP_003002815.1| hypothetical protein Dd1591_0449 [Dickeya zeae Ech1591]
MTTHITTAYGFLLALTTVSPLLHAAQPPIVVVEDHGGASAMPYYEALNLQARSPNAPLSRITLPSVQVNP
ATEADMLPVRSPKLTPGTVARRVIDAPGLQPFFLVGDDEASHVWLQRQGKSLRERKAIGLVVNVENEAGL
AHLRAITPDLQFAPVAADDLAERLGLQHYPVLITSTGIEQ
 
Nucleotide Sequence: 543 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c515979-515437 Dickeya zeae Ech1591 chromosome, complete genome
ATGACGACTCACATCACGACCGCATACGGCTTTCTCCTGGCACTCACCACCGTATCGCCGTTGCTGCATG
CAGCACAACCGCCGATCGTAGTAGTAGAGGACCATGGCGGGGCGTCAGCCATGCCGTACTACGAGGCGCT
CAACCTTCAGGCCCGTTCACCCAATGCCCCACTCTCCCGCATTACTCTTCCATCAGTACAAGTGAACCCA
GCCACCGAAGCAGACATGCTGCCAGTGCGCAGCCCGAAACTCACACCCGGCACCGTAGCACGTCGGGTCA
TCGACGCACCGGGCCTGCAGCCATTCTTTCTGGTCGGCGACGACGAAGCATCACATGTGTGGCTGCAGCG
CCAGGGGAAATCACTGCGCGAACGTAAAGCCATCGGCCTGGTAGTCAATGTCGAGAATGAGGCCGGATTG
GCACACCTACGTGCGATCACACCAGACCTGCAGTTCGCGCCGGTTGCGGCCGATGACCTGGCCGAACGCC
TTGGCCTGCAGCATTACCCCGTGCTTATCACCAGCACCGGCATTGAGCAATAA
 Primer design