SecReT4
Protein ID: 251788095
T4SS name [ID]Tfc [689]
Gene symbol-
Locus tagDd1591_0450
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T4SS(s) in this replicon]
Location [Strand]515976..516566 [-]
Productputative signal peptide
Component typeTfc4
UniProt IDC6CI91
KEGG IDdze:Dd1591_0450
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 196 a.a.     [Download]
>gi|251788095|ref|YP_003002816.1| putative signal peptide [Dickeya zeae Ech1591]
MAASALTSMRRRWILLVNILLSSLAQGQEIPPPAYQLAAQRAGIPSVVLYVVALQESGVRRAERIVPWPW
SLNVDGQSCRYASQVQACAGIHQALRDVPPTRIDVGLGQINLGWQKHRYRQPCDLLNPYNNLAIAAQILK
EQYIPGEDWLLAIGRYHRPSGGTPAARYRHGVSQHLQRVLGPQQAFTNTNSKETSP
 
Nucleotide Sequence: 591 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c516566-515976 Dickeya zeae Ech1591 chromosome, complete genome
ATGGCAGCGTCAGCCCTGACATCCATGCGACGGCGGTGGATTCTGCTGGTGAACATACTGCTGAGCAGCC
TGGCCCAAGGCCAGGAGATCCCTCCGCCTGCCTACCAGTTGGCCGCTCAACGCGCTGGCATTCCCTCCGT
CGTCCTTTATGTAGTGGCGCTGCAGGAAAGTGGCGTGCGCCGTGCAGAGCGCATCGTACCGTGGCCGTGG
TCGCTGAATGTGGACGGTCAGTCATGCCGATATGCCAGTCAGGTACAGGCCTGCGCAGGAATACACCAGG
CTCTGCGGGACGTACCACCAACCCGAATCGACGTAGGGTTGGGGCAGATTAATCTCGGTTGGCAAAAACA
TCGCTACCGCCAGCCCTGCGACTTACTCAACCCGTACAACAATCTGGCGATCGCCGCGCAGATCCTTAAA
GAGCAATACATTCCCGGTGAGGACTGGCTGCTGGCGATTGGTCGCTACCACCGACCATCTGGAGGTACGC
CTGCAGCACGCTACCGGCATGGTGTATCTCAACACCTTCAGCGCGTATTGGGGCCACAGCAAGCCTTCAC
CAACACTAATAGCAAGGAGACCTCCCCATGA
 Primer design