SecReT4
Protein ID: 251788096
T4SS name [ID]Tfc [689]
Gene symbol-
Locus tagDd1591_0451
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T4SS(s) in this replicon]
Location [Strand]516548..517255 [-]
Productputative secreted protein
Component typeTfc3
UniProt IDC6CI92
KEGG IDdze:Dd1591_0451
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 235 a.a.     [Download]
>gi|251788096|ref|YP_003002817.1| putative secreted protein [Dickeya zeae Ech1591]
MKRQMTLLIAATLTMSAMAQPPTTMQSRIVPVQGGQHRDERLAQEWGLKTDEWQRYRELMEGPIGTYSPN
LDPLSALGIEARSDEERQRYAELQVKAEARRVEKLLAYQRAYDEAWQRLNPGMQRVSLPDAGLSRNAVTG
NGRTAVFVKDNCQPCTQLVQRLQASGTAFDLYMVGSHQDDALIRAWARGAQIDPEQVRNGTITLNHDAGR
WLSLGLPGDLPASIRQVNGRWQRQP
 
Nucleotide Sequence: 708 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c517255-516548 Dickeya zeae Ech1591 chromosome, complete genome
ATGAAACGCCAGATGACGCTCCTCATCGCGGCCACTCTGACAATGTCAGCGATGGCACAGCCACCCACCA
CGATGCAGTCCCGCATCGTACCGGTTCAGGGCGGACAACATCGGGATGAACGTCTGGCTCAGGAGTGGGG
CCTGAAGACCGATGAATGGCAGCGATACCGCGAACTGATGGAGGGACCAATCGGTACTTACTCACCCAAC
CTCGATCCGCTCTCTGCACTGGGTATCGAGGCACGCAGTGATGAAGAGCGACAACGTTATGCTGAACTGC
AAGTGAAAGCAGAAGCTCGTCGCGTCGAAAAGCTGCTGGCCTATCAGCGCGCATACGACGAAGCGTGGCA
AAGACTCAACCCTGGCATGCAGCGGGTAAGTTTGCCTGATGCCGGGCTCAGCAGAAACGCGGTGACCGGC
AACGGACGCACGGCGGTGTTCGTCAAGGACAATTGCCAGCCATGCACCCAGCTTGTGCAGCGTTTACAGG
CCTCCGGCACCGCATTTGACCTGTATATGGTCGGCTCACACCAGGACGATGCGCTCATCCGCGCCTGGGC
CAGAGGTGCGCAGATTGACCCTGAGCAGGTACGCAATGGCACCATTACTCTGAACCACGACGCCGGTCGC
TGGTTGTCTCTGGGGCTGCCCGGAGACCTGCCCGCCAGTATCAGACAGGTTAATGGCCGATGGCAGCGTC
AGCCCTGA
 Primer design