SecReT4
Protein ID: 251788098
T4SS name [ID]Tfc [689]
Gene symbol-
Locus tagDd1591_0453
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T4SS(s) in this replicon]
Location [Strand]517914..518483 [-]
Productputative secreted protein
Component typeTfc2
UniProt IDC6CI94
KEGG IDdze:Dd1591_0453
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 189 a.a.     [Download]
>gi|251788098|ref|YP_003002819.1| putative secreted protein [Dickeya zeae Ech1591]
MSPTHSTRRLFVSHLLIIAALSSGCTTTTAPPPLPPIKAVSPVPDATSNFIPIVRYGRYTLVELAPNAAQ
HDLLLQIIDVAIPEDTRATVGDGLRHVLKRSGYQLCETAQSLIELYSLPLPAAHLHMGPMTLRDALLTLA
GPAWDMQVDDRVRQVCFVRASTDSEVSAAPSNLPAAKADTSALPSGGQP
 
Nucleotide Sequence: 570 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c518483-517914 Dickeya zeae Ech1591 chromosome, complete genome
ATGTCACCCACACATTCAACCCGGCGGCTGTTCGTCAGTCACCTGCTGATCATTGCAGCCTTGAGCAGCG
GATGCACAACAACCACTGCCCCGCCCCCCTTACCGCCCATCAAAGCGGTATCCCCGGTTCCCGACGCGAC
GTCGAACTTCATCCCAATCGTGCGCTACGGGCGCTATACCCTTGTTGAACTGGCACCCAATGCGGCGCAA
CACGACCTGCTGCTACAGATAATTGACGTGGCAATACCCGAAGACACCCGCGCCACTGTAGGTGATGGCC
TGCGGCATGTTCTCAAGCGCAGCGGTTACCAGCTCTGTGAAACAGCACAATCCCTCATTGAACTGTATTC
ACTTCCGCTCCCCGCCGCTCACCTGCACATGGGGCCCATGACCCTACGCGACGCTCTGCTGACCCTGGCT
GGCCCAGCGTGGGATATGCAAGTCGATGACCGAGTGCGGCAGGTGTGCTTTGTACGCGCCAGCACAGATA
GCGAAGTCAGTGCAGCTCCCAGCAACCTCCCAGCCGCCAAAGCAGATACATCTGCCCTGCCCTCAGGAGG
TCAGCCATGA
 Primer design