SecReT4
Protein ID: 251789093
T4SS name [ID]VirB [417]
Gene symbol-
Locus tagDd1591_1477
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T4SS(s) in this replicon]
Location [Strand]1696183..1698012 [-]
Producttype IV conjugative transfer system coupling protein TraD
Component typeVirD4
UniProt IDC6CEY4
KEGG IDdze:Dd1591_1477
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.2e-10, Aligned region: 369..565
TrwB_AAD_bind [PF10412], Evalue: 1e-09, Aligned region: 410..567
AAA_10 [PF12846], Evalue: 4.8e-08, Aligned region: 407..508
TraG-D_C [PF12696], Evalue: 1.2e-07, Aligned region: 429..528
Protein Sequence: 609 a.a.     [Download]
>gi|251789093|ref|YP_003003814.1| type IV conjugative transfer system coupling protein TraD [Dickeya zeae Ech1591]
MGDSHVRGVDLPSLSAMRDARPTTLKRENIAMGTPLMQRMNTFIDAFSFFLLSLQNHPAILSLLAGLTLP
FIFNLPRQERENAPLWLKSVACVSVFFFTFGTLSPLTIEGLSFFFNALDRHTLFNSPLWILTASFTFAGL
IFHIMVSRLLSGEIDKLKHRLIKKSKLERSIRTDVREVKNMLPDSIAYNPLDHIDLNNGVFIGLDKDDQP
QYISIDEFQSQHADLIGTTGSGKGVSACVLLYQAILSGEGVFVEDPKNDEWAPHVLREACQKAGKPFVLI
NLNALHFQLDLLADISHEQLEELFNAGFSLGKKGEGADFYRIADRRAARNAAAIYEKGMTLRDLFNTPFV
TSLAEDMPAFYGELEEIALINAINASHGFSLKTIFDEGGCCYIIGSMRNQKIISAQRMILTRLIQIAETR
DRIKEQPRPVAIFLDELKYHLSRPALEGLGAARDKGVHIIMAHQSVKDLYDCPADLDGEAVAGSVIENCK
FMLVYRLRDPDTADWVARMTGSILVDDEMRKVKTDSFLTEKIDTDRMIRQAERYYIDTNMLLNLPKFVGF
VFTQNDLAKATKLSPVPAKKESLALLSFEPKIALQDVNKVHAHKPSVNL
 
Nucleotide Sequence: 1830 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c1698012-1696183 Dickeya zeae Ech1591 chromosome, complete genome
ATGGGAGACAGTCATGTGAGAGGGGTTGATCTCCCATCGCTGTCTGCCATGCGTGACGCCCGGCCAACAA
CACTCAAGCGGGAGAATATTGCGATGGGAACTCCTCTGATGCAAAGGATGAATACGTTTATCGACGCCTT
TTCCTTCTTCCTTTTATCGCTACAAAACCATCCGGCAATATTATCGTTACTTGCCGGACTGACGCTGCCA
TTCATATTTAACCTGCCACGGCAAGAAAGAGAAAATGCGCCTTTGTGGTTGAAATCTGTCGCATGTGTCT
CTGTCTTCTTTTTTACCTTCGGAACCCTCTCCCCGCTGACTATCGAGGGGCTGAGTTTTTTCTTTAACGC
ACTCGACAGACACACGCTTTTCAACAGCCCGCTCTGGATACTGACCGCCTCTTTTACGTTTGCCGGGTTA
ATATTTCATATTATGGTCAGCAGACTTCTCTCGGGTGAGATAGATAAACTAAAGCACCGATTGATTAAAA
AAAGCAAACTGGAAAGAAGTATCAGAACGGATGTTCGGGAAGTAAAAAACATGCTGCCTGACAGCATTGC
CTATAATCCGCTGGATCATATTGACTTAAACAACGGCGTTTTTATTGGTCTTGATAAAGACGATCAACCA
CAATATATCTCCATTGACGAATTTCAGTCCCAGCACGCTGACCTTATCGGCACCACAGGCTCCGGTAAAG
GGGTCAGCGCCTGTGTTTTACTTTACCAGGCGATTCTTTCAGGTGAGGGGGTATTTGTCGAAGATCCTAA
AAATGATGAGTGGGCACCACATGTATTGCGGGAAGCCTGTCAGAAAGCGGGAAAACCATTCGTCCTCATT
AACCTGAATGCGCTCCATTTTCAGCTTGATTTACTGGCGGATATTTCACACGAACAACTGGAAGAACTGT
TTAATGCCGGGTTTAGCCTGGGTAAAAAAGGTGAAGGTGCTGACTTTTATCGTATAGCCGATCGTCGGGC
AGCCAGAAACGCCGCAGCCATTTATGAAAAAGGGATGACGTTACGTGACCTGTTTAATACGCCCTTTGTC
ACATCACTTGCGGAGGATATGCCTGCTTTTTATGGCGAGCTTGAGGAAATCGCGTTAATTAATGCGATTA
ATGCCAGTCATGGTTTTTCTCTAAAGACAATATTTGATGAAGGTGGATGCTGTTACATTATTGGCTCGAT
GCGTAATCAAAAAATCATATCAGCTCAGCGCATGATATTAACCCGTCTGATTCAGATAGCCGAAACACGA
GACAGAATAAAAGAACAACCTCGCCCTGTTGCCATTTTTCTTGATGAACTTAAATATCACCTTTCCCGCC
CGGCGCTTGAGGGGCTGGGTGCCGCGAGGGACAAAGGTGTGCATATCATCATGGCCCACCAGTCGGTAAA
AGATTTATATGACTGTCCGGCCGATCTGGATGGTGAGGCCGTTGCAGGCTCGGTGATTGAGAACTGTAAA
TTCATGCTGGTTTATCGTCTTCGTGATCCCGACACGGCTGACTGGGTGGCAAGAATGACCGGCTCTATTC
TGGTTGATGACGAAATGAGGAAAGTGAAGACGGATAGCTTCCTGACAGAGAAAATCGATACAGACCGAAT
GATCCGCCAGGCAGAACGATATTACATCGACACAAATATGCTGCTTAATCTGCCTAAATTTGTTGGCTTT
GTTTTTACGCAGAATGACCTTGCCAAAGCCACAAAGCTTTCCCCTGTCCCGGCAAAAAAGGAATCTCTCG
CATTACTCTCATTTGAACCAAAAATCGCTTTACAGGATGTAAATAAAGTCCATGCGCATAAACCATCCGT
TAACCTGTGA
 Primer design