SecReT4
Protein ID: 251789095
T4SS name [ID]VirB [417]
Gene symbol-
Locus tagDd1591_1479
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T4SS(s) in this replicon]
Location [Strand]1699026..1700042 [-]
ProductSigma 54 interacting domain-containing protein
Component typeVirB11
UniProt IDC6CEY6
KEGG IDdze:Dd1591_1479
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4.7e-49, Aligned region: 17..310
Protein Sequence: 338 a.a.     [Download]
>gi|251789095|ref|YP_003003816.1| Sigma 54 interacting domain-containing protein [Dickeya zeae Ech1591]
MNAENLSLYFMKNQLFGEFLPLAGLTEIAINRPGEIHTKINGRWQRHESPVTLRQCHAFANALASWHDDN
IDDTSPILSATLESGERIQAIIPPACERNTVSITLRKPSYAQKTHQSWIEAGFYHRVTGQEQTESKDEEL
TRYYNNGDIPRFIEKAVEYGKTLFIVGETGSGKTTYMKTLLHYIPPHLRLTTIEDNPEIRFYHHTNYVHL
FYPAEATDEAIVTPGRLIRANYRMNPDRILLAEIRGREAWDALKIIGSGHEGLITSLHAGSPEECIEGLI
DRCYENPDCNNIPFDVLLRKVLKSIDVIVSIDIHGDVRRMSDIYFKPVHLHHMKEIFR
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c1700042-1699026 Dickeya zeae Ech1591 chromosome, complete genome
ATGAACGCTGAAAACCTGTCGCTTTATTTCATGAAAAATCAGCTATTTGGTGAATTTCTGCCACTGGCAG
GCCTGACGGAAATCGCCATTAACCGCCCCGGTGAGATCCACACCAAAATAAACGGTCGATGGCAGAGGCA
TGAATCGCCGGTCACCTTGCGTCAGTGCCATGCCTTTGCCAACGCGCTGGCCTCATGGCATGACGATAAT
ATTGATGACACGTCGCCGATTCTGTCCGCTACGCTGGAGTCCGGCGAACGCATTCAGGCCATTATTCCCC
CGGCCTGCGAGCGGAATACCGTGTCCATCACGCTGCGCAAACCGTCATATGCGCAGAAAACGCATCAGTC
GTGGATTGAGGCGGGCTTTTATCACCGTGTAACCGGTCAGGAGCAGACTGAAAGCAAGGACGAGGAGCTG
ACCCGCTATTACAACAACGGGGACATCCCCCGCTTTATTGAAAAAGCCGTCGAGTACGGCAAAACGCTCT
TTATTGTGGGGGAAACCGGCTCGGGTAAAACCACCTACATGAAGACGTTGCTGCACTATATTCCGCCGCA
TCTCAGGCTGACGACGATTGAAGACAACCCTGAAATCCGGTTTTACCACCACACCAATTATGTGCATCTG
TTTTACCCGGCAGAGGCCACCGACGAGGCGATTGTCACCCCCGGCAGGCTGATACGGGCGAATTATCGAA
TGAATCCGGACAGAATTCTGCTGGCGGAAATTCGCGGGCGGGAAGCCTGGGACGCACTGAAAATTATCGG
CTCCGGCCATGAAGGGCTTATTACCTCCCTGCACGCGGGCAGCCCGGAAGAGTGTATTGAGGGACTCATC
GACCGCTGCTATGAAAACCCGGACTGCAACAATATCCCGTTCGATGTGCTGTTACGCAAGGTGCTAAAAA
GCATTGATGTGATCGTCAGTATTGATATTCATGGCGACGTTCGCCGGATGAGCGATATTTATTTTAAACC
GGTACACCTTCATCACATGAAGGAAATATTCAGATAG
 Primer design