SecReT4
Protein ID: 251789096
T4SS name [ID]VirB [417]
Gene symbol-
Locus tagDd1591_1480
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T4SS(s) in this replicon]
Location [Strand]1700032..1701234 [-]
Productconjugation TrbI family protein
Component typeVirB10
UniProt IDC6CEY7
KEGG IDdze:Dd1591_1480
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 6e-52, Aligned region: 203..385
Protein Sequence: 400 a.a.     [Download]
>gi|251789096|ref|YP_003003817.1| conjugation TrbI family protein [Dickeya zeae Ech1591]
MTDHPIPDTAEKTVAEREAEARERARAARESQTPAHNTPPGQPEVTRFKKPASRRTLLVSLLSLAVLMLL
AWSGDRFFGAVKHSDDKAAETQPPTGVIPPARKNLGMDRHPFGLFEQSRPETTTDHRQTQAAPPPPAPPA
LNKAAALADGLSQASDTASASHVTASGTDKQKPTTAPAPEIKDTAPGVVTVTHVRRLGLDPDLYLPVDSY
IPCSMMQRFVSDVGGRISCLISEDVYSASHHVKLLPAGTVARGVYRTGALLQGRSRMFVIWTALRTPEPG
SLHIPLTDTEASGPLGEAGISGRIDTHFWERFGNALMLSTVQDVAAAAANTAPGKDRNTDYTENTRAAAS
EMAKTALENSINIPPTMYLNQGDVIGIMTGTDIDFSSVYQLRLKKRWYER
 
Nucleotide Sequence: 1203 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c1701234-1700032 Dickeya zeae Ech1591 chromosome, complete genome
ATGACAGACCATCCCATCCCGGATACAGCGGAAAAAACCGTGGCTGAGCGGGAAGCCGAAGCCCGTGAAC
GCGCCAGAGCCGCGAGAGAAAGCCAGACACCGGCGCACAACACGCCGCCCGGTCAGCCGGAAGTCACCCG
CTTTAAAAAACCCGCTAGTCGCCGAACGCTGCTGGTCAGCCTGCTCAGTCTGGCTGTGCTGATGCTGCTG
GCATGGAGTGGGGATCGCTTTTTTGGCGCAGTCAAACACAGCGATGACAAGGCGGCGGAGACCCAGCCGC
CGACCGGTGTAATACCGCCTGCGCGTAAAAACCTCGGTATGGACCGTCATCCGTTCGGTCTGTTCGAGCA
GAGCAGACCGGAAACCACAACGGATCATCGCCAGACGCAGGCTGCTCCGCCACCGCCAGCACCGCCCGCG
TTAAACAAAGCCGCCGCCCTGGCCGACGGGTTAAGTCAGGCGTCAGATACCGCATCGGCTTCCCACGTCA
CCGCCTCCGGCACCGACAAGCAAAAGCCCACTACCGCGCCTGCCCCGGAGATAAAAGACACCGCTCCCGG
CGTGGTAACAGTCACCCACGTCCGGCGGCTCGGTCTCGATCCCGATCTCTACCTGCCAGTTGATAGCTAC
ATTCCCTGCTCGATGATGCAGCGCTTTGTTTCCGATGTCGGCGGGCGGATTTCCTGCCTCATCAGCGAGG
ATGTCTACAGCGCCAGTCATCATGTGAAGCTGCTCCCGGCAGGCACGGTCGCCCGTGGCGTCTATCGTAC
CGGCGCACTGCTACAGGGCCGGAGCCGGATGTTTGTCATCTGGACGGCGTTACGCACACCAGAGCCCGGT
AGCCTGCACATTCCGCTGACCGATACCGAGGCCAGCGGCCCGTTGGGAGAAGCCGGGATTAGCGGCAGGA
TCGATACCCATTTCTGGGAGCGGTTCGGCAATGCATTGATGTTGAGCACAGTGCAGGACGTCGCCGCAGC
GGCGGCGAATACAGCGCCGGGGAAAGACCGTAATACCGACTACACCGAGAATACGCGTGCTGCCGCCTCG
GAGATGGCAAAAACGGCCCTGGAAAACAGCATCAATATCCCGCCCACGATGTACCTCAATCAGGGGGATG
TGATCGGCATCATGACCGGCACGGATATCGATTTCTCTTCCGTTTATCAACTGCGTCTGAAAAAGAGGTG
GTATGAACGCTGA
 Primer design