SecReT4
Protein ID: 251789098
T4SS name [ID]VirB [417]
Gene symbol-
Locus tagDd1591_1482
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T4SS(s) in this replicon]
Location [Strand]1702121..1702804 [-]
ProductVirB8 family protein
Component typeVirB8
UniProt IDC6CEY9
KEGG IDdze:Dd1591_1482
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.7e-50, Aligned region: 11..223
Protein Sequence: 227 a.a.     [Download]
>gi|251789098|ref|YP_003003819.1| VirB8 family protein [Dickeya zeae Ech1591]
MSETENLIASSRTFEAVLLEKDEREKKRAWRMAATGFALAALTITALIILLPLKTTDIELWSVDKQTGRY
EYMTRLKEKDIATEAALAHALSAQYVRLREGYNYFALQHDYDDVQLFNSDSVNRDYLDEFNGNQAPDVMF
NKAEYVVSVEIISNIHAPATAPDHLATLRVKRIIRRIADNTVKTDIWNIRLTYRYLPRKQLTDSQREVNP
LGFIVTSYQRDKELRGE
 
Nucleotide Sequence: 684 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c1702804-1702121 Dickeya zeae Ech1591 chromosome, complete genome
ATGTCTGAAACAGAAAACCTCATTGCGTCATCCCGCACCTTTGAAGCGGTTCTGCTGGAAAAGGATGAAC
GGGAAAAAAAGCGCGCATGGCGCATGGCGGCAACCGGGTTTGCGCTGGCGGCGCTGACGATAACCGCGCT
GATTATTCTGCTGCCGCTGAAAACCACCGACATCGAATTATGGTCGGTGGATAAACAGACCGGGCGCTAT
GAATATATGACCCGTCTCAAGGAGAAGGATATCGCTACCGAAGCAGCGCTGGCGCATGCGCTATCCGCCC
AGTACGTCCGGCTGCGCGAAGGCTATAACTATTTTGCGCTTCAGCACGATTATGACGACGTGCAGCTATT
CAACAGCGACAGCGTGAACCGGGATTACCTCGACGAGTTTAACGGCAATCAGGCCCCCGACGTCATGTTC
AATAAAGCGGAATACGTCGTGTCTGTCGAGATTATTTCCAACATTCACGCCCCCGCCACCGCCCCTGACC
ACCTGGCAACCTTGCGAGTTAAACGCATAATCCGCCGCATTGCGGATAACACGGTCAAAACGGATATCTG
GAACATCCGCCTGACCTACCGCTACCTCCCCCGCAAACAACTGACGGACAGCCAGCGAGAAGTGAACCCA
TTGGGGTTCATCGTCACCAGCTACCAGCGCGATAAAGAACTGAGGGGGGAGTGA
 Primer design