SecReT4
Protein ID: 251789099
T4SS name [ID]VirB [417]
Gene symbol-
Locus tagDd1591_1483
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T4SS(s) in this replicon]
Location [Strand]1702797..1702937 [-]
Productputative conjugal transfer protein
Component typeVirB7
UniProt IDC6CEZ0
KEGG IDdze:Dd1591_1483
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 46 a.a.     [Download]
>gi|251789099|ref|YP_003003820.1| putative conjugal transfer protein [Dickeya zeae Ech1591]
MKSSIVFLMLCILTGCAGHQHDLPPVSGDPQPVNSPAIIQELTTHV
 
Nucleotide Sequence: 141 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c1702937-1702797 Dickeya zeae Ech1591 chromosome, complete genome
ATGAAATCCAGCATTGTCTTTCTGATGCTGTGCATCCTCACGGGCTGCGCAGGGCATCAACACGACCTTC
CGCCGGTATCCGGCGATCCTCAACCGGTCAATTCCCCCGCGATTATTCAGGAGCTGACAACACATGTCTG
A
 Primer design