SecReT4
Protein ID: 251789100
T4SS name [ID]VirB [417]
Gene symbol-
Locus tagDd1591_1484
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T4SS(s) in this replicon]
Location [Strand]1703025..1704053 [-]
ProductTrbL/VirB6 plasmid conjugal transfer protein
Component typeVirB6
UniProt IDC6CEZ1
KEGG IDdze:Dd1591_1484
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.1e-43, Aligned region: 41..259
Protein Sequence: 342 a.a.     [Download]
>gi|251789100|ref|YP_003003821.1| TrbL/VirB6 plasmid conjugal transfer protein [Dickeya zeae Ech1591]
MSGGMFVGMNNTITDGLQAILRGQTSVYGDMVSIIAVSSFTVFVTYQGYQTLAGKRQTPVEDVMWDIGRM
LLIMTFVLNLDGWLNLAIAAINGLKDGVSGDDNVWSLLDTVWDKAQTIGQKLYQQDDSAYVKLNGGVAEI
LVWGGVIVTLLFGATVNLLAEIIIVLMTTTAPLFIFCLLYGFLTPMFNNWMKIIFTVILTMMFSALSIRI
VINYLNGILDKAVNFADSANIITLGVQCCVAGVISGVIIWFSAKIANALSGVAVQATLQGVAMSGLRGLA
NTSSEAAKPAMKTGVAAARLAAKGSHAAGTLIATGTGNAISAWQKRAAAIESMKRLNQQHPR
 
Nucleotide Sequence: 1029 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c1704053-1703025 Dickeya zeae Ech1591 chromosome, complete genome
ATGTCGGGTGGTATGTTTGTTGGAATGAACAACACTATCACTGACGGCCTACAAGCCATACTGCGGGGGC
AAACCTCCGTCTATGGCGATATGGTAAGTATTATCGCCGTCAGTTCCTTCACTGTATTTGTCACTTATCA
GGGTTATCAAACCCTAGCCGGAAAACGCCAAACACCCGTCGAAGATGTCATGTGGGATATAGGGCGAATG
TTATTAATCATGACATTCGTTTTAAATCTCGATGGCTGGCTGAATTTAGCCATTGCGGCCATTAACGGCT
TAAAAGACGGCGTCAGCGGTGATGATAATGTCTGGTCATTGCTCGATACCGTCTGGGATAAAGCACAGAC
CATTGGGCAAAAACTTTATCAACAGGATGATTCCGCCTATGTAAAGCTCAATGGCGGTGTTGCCGAAATT
CTGGTCTGGGGCGGTGTTATTGTCACACTGCTTTTTGGCGCTACGGTTAACCTGTTAGCCGAAATTATCA
TTGTATTAATGACGACGACCGCGCCATTATTTATTTTCTGCCTGTTGTATGGGTTCCTGACTCCAATGTT
TAACAACTGGATGAAAATTATTTTTACGGTCATCCTTACAATGATGTTTTCGGCTTTATCAATCAGGATC
GTCATTAATTATCTCAATGGTATCTTAGATAAGGCGGTTAATTTTGCCGACAGCGCCAATATCATTACGC
TTGGTGTTCAGTGTTGTGTTGCGGGCGTTATTTCCGGCGTCATTATCTGGTTTTCCGCAAAGATAGCCAA
CGCACTGAGCGGTGTCGCCGTTCAGGCTACCTTGCAGGGGGTCGCCATGAGCGGCTTACGCGGGCTGGCG
AACACGTCGTCTGAGGCGGCAAAACCGGCGATGAAAACCGGGGTGGCGGCGGCCCGGCTGGCCGCCAAAG
GCAGCCATGCCGCTGGGACACTTATCGCCACGGGCACCGGCAACGCCATCTCCGCATGGCAAAAGCGCGC
CGCCGCCATTGAGAGTATGAAGCGCCTTAACCAACAGCATCCTCGCTAA
 Primer design