SecReT4
Protein ID: 251789103
T4SS name [ID]VirB [417]
Gene symbol-
Locus tagDd1591_1487
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T4SS(s) in this replicon]
Location [Strand]1705041..1707788 [-]
ProductCagE TrbE VirB component of type IV transporter system
Component typeVirB4
UniProt IDC6CEZ4
KEGG IDdze:Dd1591_1487
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 6.7e-42, Aligned region: 271..472
AAA_10 [PF12846], Evalue: 1.1e-34, Aligned region: 535..834
VirB3 [PF05101], Evalue: 7e-10, Aligned region: 2..82
Protein Sequence: 915 a.a.     [Download]
>gi|251789103|ref|YP_003003824.1| CagE TrbE VirB component of type IV transporter system [Dickeya zeae Ech1591]
MTTLNKALTRPAAIMGIPIVPFVLVSGAIVLLSVYVSYYLTLLLIPAWLEMRAKARADIHYFGLLWLAFK
TRGRFGTNRHFGATAMLANQYDAVDISEFTDKMKLNARITLDKYIPYSSHLHPHVIRNRHGDFVASWELG
GTLFECEDEHHLTLMTSHLNNLIRAYEGLPVTFYIHRIRETYQDAFEATSGIPFSDEVAARYYRALNAKP
LWRHRLFFTVCYAPFSALEKKAMKTQPAGKRQAALDEALKVMLEYHAALGSALSRYMATPLGTYEEKGRV
YSSQLAFYHRLITGQWQPVAVTRSPFYLTLSTPDVFFTTDTAECQTVGGSRFFRSLEIKDYSPETATGLL
DALLYAESEYVLTQSFTCMARDEAQHHIRLAEKRLNATDDDALSQREELVVLRDLLQSGHVSCGKYHFSL
LVSSASADQVVRETHALAQPFTDLGIMTSLSTLSLPAAYLAQLPGMYPFRPRLVVVSSQNYADLGSLHNF
HPHKRSGNPWGDAIAILTSPGGGGYYLNLHDSQVGRDDFNEKTPGNTAIIGKTGSGKTLLMTMMQHLMQK
YRHPATFSAAAPGKRLTTVYFDKDRAAEMSIRQMGGRYFRIRTGTPAGFNPFSLAPTRRNISFIKQLVRM
LCRRNGKPLDPRDEARISAAVDTLMQDYPPELRRYGITRLLEVLPEPPTREARTNGLRIRLKQWAQGGEF
GWIFDNAEDSFNIGESDNIGIDGTEFLDDDDIRGPITFYLLFRVTSLLDGRRLVMFMDEFWKWLADVEFS
RFSLNMLKVIRKLNGIFIPATQSPDEIVRHPIAPAIIEQCSTQIFLANPKASRADYVEKMNVPDSVYDTV
RRLDPGEHYMVIMKTPLRAGETRPFVALARMDLSGIGNLTTILSGSEDNLKRFDALYQEGMSPQDWKAAF
LEQAI
 
Nucleotide Sequence: 2748 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c1707788-1705041 Dickeya zeae Ech1591 chromosome, complete genome
ATGACCACCCTGAATAAAGCGCTCACCCGGCCCGCCGCCATTATGGGCATCCCCATCGTCCCATTCGTTC
TCGTCAGCGGGGCCATCGTCCTGCTGTCGGTCTATGTCAGCTATTACCTGACGCTATTACTGATCCCGGC
CTGGCTGGAAATGCGGGCGAAGGCCCGAGCCGATATCCATTATTTCGGGTTGTTATGGCTGGCGTTTAAA
ACCCGTGGCCGGTTTGGCACGAACCGGCATTTTGGCGCGACGGCGATGCTGGCAAACCAGTATGACGCCG
TCGATATTTCGGAGTTTACCGACAAGATGAAATTAAACGCGCGCATCACGCTGGATAAATACATCCCCTA
CTCTTCCCACCTTCACCCGCACGTCATCAGAAACCGCCACGGTGATTTCGTCGCCTCCTGGGAGCTGGGC
GGCACCCTGTTTGAATGTGAGGATGAACATCATCTGACGCTGATGACAAGCCATCTCAACAACCTGATCC
GCGCCTATGAAGGGCTGCCGGTCACGTTCTATATTCACCGAATACGGGAGACCTATCAGGATGCCTTTGA
GGCGACCTCGGGTATTCCGTTTTCCGACGAAGTCGCGGCACGCTATTACCGGGCACTCAACGCGAAGCCG
CTCTGGCGGCATCGGCTGTTTTTCACCGTCTGTTATGCGCCCTTCTCCGCACTGGAGAAAAAGGCCATGA
AGACACAGCCCGCCGGAAAAAGGCAGGCGGCGCTGGATGAAGCGCTGAAGGTCATGCTGGAGTACCATGC
CGCACTCGGCAGCGCACTGTCACGCTATATGGCGACCCCTCTGGGAACCTATGAGGAGAAAGGACGGGTC
TACTCCTCGCAACTGGCGTTCTACCATCGCCTGATCACCGGCCAATGGCAGCCGGTGGCGGTGACACGCT
CACCGTTTTACCTCACGCTCAGTACACCGGATGTGTTTTTTACCACCGATACCGCCGAATGCCAGACCGT
CGGCGGCTCCCGGTTCTTCCGCAGTCTGGAAATTAAGGACTATTCACCGGAGACCGCGACCGGCCTGCTG
GATGCGCTGTTGTATGCCGAAAGCGAGTACGTACTGACGCAGTCTTTCACCTGCATGGCACGGGATGAGG
CACAACACCATATCCGGCTGGCGGAAAAACGGCTGAATGCAACCGACGATGACGCACTGTCACAGCGTGA
AGAGCTGGTTGTCTTGCGCGATCTGCTCCAGTCCGGGCATGTGTCCTGCGGCAAATACCATTTTTCCCTG
CTGGTGTCCTCGGCCAGTGCCGATCAGGTGGTCAGGGAGACCCACGCGCTGGCCCAGCCGTTTACCGACC
TCGGTATCATGACCTCGCTGTCCACGCTGTCGTTACCTGCCGCCTATCTGGCTCAACTGCCCGGCATGTA
TCCCTTTCGCCCCCGGCTGGTGGTCGTCAGCAGCCAGAACTACGCGGATCTGGGTAGCCTGCATAACTTT
CACCCTCACAAGCGCAGCGGCAATCCGTGGGGCGACGCCATCGCCATTCTGACATCGCCCGGCGGCGGAG
GTTATTACCTGAACCTGCACGACAGCCAGGTCGGGCGGGATGACTTCAACGAGAAAACACCGGGGAATAC
CGCCATCATCGGCAAAACCGGCTCAGGGAAGACCCTGCTGATGACGATGATGCAACACCTGATGCAGAAG
TACCGCCACCCGGCGACATTTTCCGCTGCGGCCCCCGGTAAACGGCTGACTACCGTTTACTTTGATAAAG
ACCGGGCCGCCGAGATGTCGATCCGCCAGATGGGCGGGCGTTACTTTCGCATCCGCACCGGTACGCCTGC
CGGGTTCAACCCGTTCTCCCTTGCACCAACCCGACGCAACATCAGCTTTATCAAGCAATTGGTCCGCATG
TTGTGCCGTCGCAACGGCAAACCGCTCGACCCACGCGATGAAGCGCGCATCAGCGCCGCCGTGGATACCC
TGATGCAGGACTACCCGCCGGAATTGCGCCGTTATGGCATTACCCGGCTGCTGGAGGTGTTGCCCGAGCC
GCCGACCCGCGAGGCCAGAACCAACGGGCTGCGCATCCGTCTGAAACAGTGGGCGCAGGGCGGCGAATTC
GGCTGGATTTTCGATAACGCGGAAGACAGCTTTAACATCGGCGAGAGCGATAACATCGGCATCGATGGAA
CAGAATTTCTGGATGACGACGACATTCGCGGCCCGATCACCTTTTACCTGCTGTTCCGCGTCACCAGCCT
GCTGGACGGTCGCCGGTTGGTGATGTTCATGGATGAATTCTGGAAATGGCTGGCTGATGTCGAGTTTTCC
AGATTCTCCCTCAATATGCTCAAGGTGATCCGCAAACTGAACGGCATTTTTATCCCCGCCACCCAGTCCC
CCGATGAAATTGTCAGGCACCCCATCGCGCCCGCGATTATTGAACAGTGCAGCACACAGATCTTTCTCGC
CAATCCCAAAGCCAGCCGGGCGGATTACGTAGAGAAAATGAACGTCCCCGACAGCGTGTATGACACCGTT
CGTCGTCTGGACCCGGGAGAGCATTATATGGTCATCATGAAAACACCGCTGCGCGCCGGTGAAACCCGGC
CCTTTGTCGCCCTGGCAAGAATGGATTTATCGGGCATCGGCAATCTCACCACAATCCTGAGCGGAAGCGA
AGACAACCTGAAACGGTTTGATGCGCTTTATCAGGAGGGCATGTCCCCTCAGGACTGGAAAGCGGCCTTC
CTTGAACAGGCCATCTGA
 Primer design