SecReT4
Protein ID: 251789105
T4SS name [ID]VirB [417]
Gene symbol-
Locus tagDd1591_1489
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T4SS(s) in this replicon]
Location [Strand]1708093..1708740 [-]
ProductLytic transglycosylase catalytic
Component typeVirB1
UniProt IDC6CEZ6
KEGG IDdze:Dd1591_1489
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 3e-21, Aligned region: 9..146
Protein Sequence: 215 a.a.     [Download]
>gi|251789105|ref|YP_003003826.1| Lytic transglycosylase catalytic [Dickeya zeae Ech1591]
MLSPTAFLAAAMQCAASIHPSTAFDVAKVESGFNPYAIAEIVPKQERMPGSAGVISHQPTRDETAVSIIN
RIEAKGRRYSVGLMQITSTHFQHYGVTARALLDPCTNLSVFERILTDCYQRGGTLQRALSCYYAGNFTAG
QQPESTFNQTSYLQRIGYAVPSTQEDRTRRTNSQATSAMHYPATVLRGELAAPSTPVSTTLRYPNAVLRG
DVSPL
 
Nucleotide Sequence: 648 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c1708740-1708093 Dickeya zeae Ech1591 chromosome, complete genome
ATGCTTTCCCCGACAGCTTTTCTGGCGGCGGCGATGCAGTGTGCCGCCAGCATTCACCCGTCCACCGCAT
TTGATGTGGCAAAGGTGGAATCCGGCTTTAATCCTTACGCCATCGCTGAAATCGTGCCAAAGCAAGAGAG
AATGCCCGGCAGCGCAGGTGTTATTTCCCACCAGCCCACCCGCGATGAAACAGCCGTCAGTATCATCAAC
CGGATAGAGGCCAAAGGCCGCCGCTATTCGGTCGGGCTGATGCAAATCACCAGTACCCATTTTCAGCATT
ACGGCGTGACGGCACGGGCGTTGTTAGACCCGTGTACCAATCTGTCTGTTTTTGAGCGCATCCTTACCGA
CTGCTATCAGCGCGGCGGCACGCTGCAACGCGCACTCAGTTGCTACTACGCCGGTAATTTCACTGCCGGT
CAACAACCGGAATCCACCTTCAACCAGACCAGCTATCTCCAGCGTATTGGCTATGCCGTCCCGTCAACGC
AGGAAGACCGCACGCGTAGAACCAACAGCCAGGCCACGTCAGCGATGCATTATCCGGCCACCGTGCTGCG
CGGTGAGCTTGCCGCCCCCTCTACCCCGGTTTCGACCACCCTGCGCTACCCCAACGCCGTCCTTCGCGGC
GATGTATCCCCCCTGTGA
 Primer design