SecReT4
Protein ID: 253700961
T4SS name [ID]Trb [298]
Gene symbol-
Locus tagGM21_2344
StrainGeobacter sp. M21
Repliconchromosome [GenBank: NC_012918] [Browse all T4SS(s) in this replicon]
Location [Strand]2725701..2726747 [-]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDC6DZ84
KEGG IDgem:GM21_2344
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3.8e-52, Aligned region: 113..330
Protein Sequence: 348 a.a.     [Download]
>gi|253700961|ref|YP_003022150.1| P-type conjugative transfer protein TrbG [Geobacter sp. M21]
MKATMLSVLLLFTVSCGSMAGPPPLKSEVVPAIPVSVPSTSPAQVVPQNVEAVKSMQDAAPKGIRIKKQQ
AKKASVKKGPARRRMNERQVVEHRVKQSVQRPVNAMSVESKTLYSYVPDAIYMIYAALNHVVDVQLQPGE
NLTGRIVAGDTHRWEVGTVTDGAGANITTHVLIKPKQAGIETNFLIVTDRHSYRLYAQANDDFFIPTVGW
AYPEEEMAKSQQIRKEQQRLDGMVAAPAIIAANLNFKYKIKPDRKYPWTPIRAFDDGNKTYIQMSPEMKS
SEAPVLFIKDGKNLNLVNYRIKGDYYIVDRLFDEGELRSGKKDIVRIIRESPWFSSGKSYTDSGKMGR
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|253698656|ref|NC_012918.1|:c2726747-2725701 Geobacter sp. M21 chromosome, complete genome
ATGAAAGCCACGATGCTGTCCGTCCTTTTGCTCTTCACTGTGTCCTGCGGGAGCATGGCGGGACCGCCCC
CCTTGAAAAGCGAGGTGGTGCCCGCCATCCCCGTCTCCGTTCCCTCTACCTCCCCTGCCCAGGTGGTGCC
GCAGAACGTGGAAGCGGTGAAGTCCATGCAGGACGCAGCTCCGAAGGGAATCCGGATCAAGAAACAGCAG
GCGAAGAAGGCGTCGGTTAAGAAAGGTCCGGCCAGAAGAAGGATGAACGAGCGGCAGGTGGTTGAGCACC
GGGTGAAGCAATCCGTGCAGCGCCCGGTGAACGCCATGTCGGTTGAGAGCAAAACTCTCTACTCTTATGT
CCCGGACGCCATCTACATGATCTACGCCGCGCTGAACCACGTGGTCGACGTACAGCTGCAGCCGGGCGAA
AATCTGACCGGTCGCATCGTGGCCGGGGACACCCACCGCTGGGAGGTGGGGACCGTGACCGACGGAGCCG
GAGCCAACATCACCACGCACGTCCTGATCAAGCCCAAGCAGGCGGGGATCGAGACCAACTTCCTGATCGT
CACTGACCGCCACTCCTACCGCCTCTACGCGCAGGCGAACGACGATTTCTTCATCCCCACCGTGGGATGG
GCGTATCCCGAAGAGGAGATGGCCAAGTCACAGCAGATCCGCAAGGAGCAGCAGCGCCTGGATGGCATGG
TGGCCGCCCCGGCGATCATAGCGGCGAACCTCAACTTCAAGTACAAGATCAAGCCGGACAGGAAGTACCC
TTGGACCCCCATTCGCGCCTTCGACGACGGGAACAAAACCTATATCCAGATGTCCCCCGAGATGAAGAGC
AGCGAGGCCCCAGTCCTTTTCATCAAGGACGGGAAGAACCTGAACCTGGTCAACTACCGGATCAAGGGGG
ATTACTATATCGTGGACCGCCTGTTCGACGAGGGCGAGCTTAGAAGCGGCAAGAAGGACATAGTCAGGAT
CATCCGGGAGAGCCCCTGGTTCTCTTCTGGAAAGAGCTACACGGATAGCGGCAAGATGGGGCGCTAG
 Primer design