SecReT4
Protein ID: 253700963
T4SS name [ID]Trb [298]
Gene symbol-
Locus tagGM21_2346
StrainGeobacter sp. M21
Repliconchromosome [GenBank: NC_012918] [Browse all T4SS(s) in this replicon]
Location [Strand]2727640..2728815 [-]
ProductP-type conjugative transfer protein TrbL
Component typeTrbL
UniProt IDC6DZ86
KEGG IDgem:GM21_2346
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 5.5e-32, Aligned region: 36..253
Protein Sequence: 391 a.a.     [Download]
>gi|253700963|ref|YP_003022152.1| P-type conjugative transfer protein TrbL [Geobacter sp. M21]
MDTGILTHLLNQFLGVFSLGYGELLPDARHLLWLLATLEIALAGLWWAFDDGQRIEKALLVKIMQIGFFV
WVISNYRWLIDTILYGFIVTGTKAGGATRTDLLQDPSLIVDYGFAATDPIFRHLKDHYLAAGLPDLVLSG
LAGVLILLAYFAIAAAAFITYLEFYIISLLGLILVPFGVFKHTSFLAEKVFGAVIAYGIRLMVLAFVLAV
VEPTLAQVQLPVSPTLSQIFTVFLAAFTIAVLSWHAPGIASGLMAGSPSLGVGTMMSTGLAAGAGIVGLG
AAAGLGSAMSSAKKGLGQVIAASGGEFSHTADKTDGGGGGSMSAGNPPPDKSSGPVSSSGPSPSSSSSSR
TPSSSDGSGMPVWAQNLMLAQHAIPQESHPGTGMSAPIRHD
 
Nucleotide Sequence: 1176 bp     [Download]
>gi|253698656|ref|NC_012918.1|:c2728815-2727640 Geobacter sp. M21 chromosome, complete genome
ATGGATACTGGAATTCTCACTCATCTTCTGAATCAATTTTTGGGTGTGTTCTCTCTGGGGTATGGCGAGT
TACTTCCAGATGCCCGTCATCTTTTGTGGCTGCTCGCCACTTTGGAAATAGCCTTGGCAGGATTATGGTG
GGCTTTTGATGACGGACAAAGAATTGAGAAAGCCCTGCTTGTAAAGATCATGCAGATCGGGTTCTTTGTT
TGGGTTATAAGCAACTATAGGTGGTTAATAGATACGATATTGTACGGATTTATAGTCACTGGCACCAAAG
CAGGGGGGGCTACGCGTACGGACCTTTTGCAGGATCCTTCACTGATTGTTGATTACGGTTTTGCGGCTAC
GGATCCTATTTTTAGACATTTAAAAGACCATTACCTCGCGGCAGGGCTCCCGGATCTTGTCCTTTCAGGG
CTTGCGGGTGTGCTGATACTTCTCGCCTATTTCGCAATTGCCGCAGCGGCTTTTATCACCTACCTGGAAT
TCTATATCATTTCACTGCTTGGCTTGATTCTAGTTCCGTTTGGGGTCTTTAAACATACTTCCTTTTTGGC
GGAGAAAGTCTTTGGCGCCGTAATCGCCTACGGCATCCGACTCATGGTCTTAGCTTTTGTACTGGCCGTA
GTTGAACCAACTCTGGCCCAAGTCCAGCTGCCTGTCAGTCCAACTCTGTCGCAGATATTCACTGTGTTCC
TTGCAGCTTTTACCATCGCCGTGTTGTCCTGGCACGCTCCCGGTATTGCAAGCGGTTTGATGGCTGGTTC
ACCCTCATTGGGCGTTGGCACCATGATGAGTACGGGATTAGCCGCTGGAGCCGGTATCGTCGGACTTGGA
GCAGCCGCTGGGTTAGGTTCCGCCATGAGTTCAGCGAAAAAGGGGTTAGGGCAGGTAATCGCGGCGTCAG
GGGGTGAGTTCTCCCATACAGCAGACAAGACTGACGGTGGAGGTGGCGGTAGCATGTCTGCCGGGAATCC
TCCGCCAGACAAGTCTTCAGGCCCGGTCTCTTCATCAGGCCCCTCGCCAAGTTCATCTAGTTCATCAAGG
ACACCTTCATCATCAGACGGTTCTGGAATGCCAGTCTGGGCTCAGAACCTCATGCTGGCGCAGCACGCCA
TCCCGCAGGAATCGCATCCAGGAACCGGCATGTCGGCCCCTATAAGGCACGACTAA
 Primer design