SecReT4
Protein ID: 253700967
T4SS name [ID]Trb [298]
Gene symbol-
Locus tagGM21_2350
StrainGeobacter sp. M21
Repliconchromosome [GenBank: NC_012918] [Browse all T4SS(s) in this replicon]
Location [Strand]2732273..2732587 [-]
Productconjugal transfer protein Trbc
Component typeTrbC
UniProt IDC6DZ90
KEGG IDgem:GM21_2350
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.1e-22, Aligned region: 4..95
Protein Sequence: 104 a.a.     [Download]
>gi|253700967|ref|YP_003022156.1| conjugal transfer protein Trbc [Geobacter sp. M21]
MRTKEKVVGLWFALVVFLTTQPAFAGGSSMPWESPLNNILNSITGPVAKAGGVLAIVATGFGLAFSEGGG
FMRKVVGVVFGLSITFSAGTFISDFLGYGGGAGF
 
Nucleotide Sequence: 315 bp     [Download]
>gi|253698656|ref|NC_012918.1|:c2732587-2732273 Geobacter sp. M21 chromosome, complete genome
ATGAGGACTAAAGAAAAGGTCGTCGGTCTCTGGTTCGCTCTCGTCGTATTCCTCACCACACAGCCGGCTT
TCGCAGGCGGCTCCAGCATGCCGTGGGAATCCCCGCTCAACAACATCCTCAACAGCATCACCGGGCCAGT
GGCCAAGGCCGGAGGGGTTTTGGCCATCGTTGCGACCGGATTTGGCCTTGCCTTCAGCGAGGGAGGCGGG
TTCATGAGGAAGGTCGTCGGCGTCGTTTTCGGCCTCTCCATCACCTTCTCCGCCGGGACTTTCATCTCCG
ATTTTCTCGGTTACGGCGGCGGGGCCGGTTTCTGA
 Primer design