SecReT4
Protein ID: 253723647
T4SS name [ID]Trb [57]
Gene symbolTraF
Locus tagpP9014_p08
StrainPhotobacterium damselae subsp. piscicida plasmid pP9014 (NC_012919)
Repliconplasmid pP9014 [GenBank: NC_012919] [Browse all T4SS(s) in this replicon]
Location [Strand]10269..10796 [-]
ProductTraF protein
Component typeTraF
UniProt IDC5NNB6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 1.4e-42, Aligned region: 29..174
Protein Sequence: 175 a.a.     [Download]
>gi|253723647|ref|YP_003023933.1| TraF protein [Photobacterium damselae subsp. piscicida]
MMKRIYSGVAIVGASLMVLGATCYFSGARINTTKSIPVGLYWTTDAPIEKGAYVLFCPPEIGVFATAKER
GYIAAGFCPGDYGYMMKRILAAKGDTVKITDEGVLVEGSLLKHSKLKTTDPAGRELPRYQTSQYTLGNSE
LLLMSDVSGTSFDARYFGPVNRSQVKAVIRPVFTW
 
Nucleotide Sequence: 528 bp     [Download]
>gi|253723639|ref|NC_012919.1|:c10796-10269 Photobacterium damselae subsp. piscicida plasmid pP9014 DNA, complete sequence
ATGATGAAGCGAATTTATTCAGGTGTCGCAATTGTTGGCGCGTCTCTTATGGTGCTCGGAGCAACCTGTT
ATTTCTCTGGTGCTCGAATCAACACAACAAAAAGCATTCCTGTCGGCCTGTATTGGACCACTGACGCACC
AATAGAAAAAGGGGCTTATGTTCTTTTTTGCCCGCCTGAAATTGGTGTGTTTGCTACTGCAAAAGAACGT
GGTTACATCGCCGCCGGATTCTGTCCAGGTGACTATGGCTACATGATGAAGCGAATTTTAGCGGCTAAAG
GTGACACCGTAAAAATCACTGATGAAGGGGTTTTAGTTGAAGGTAGCTTGCTGAAACACAGCAAGTTAAA
AACTACGGACCCAGCAGGGAGAGAATTGCCTCGATACCAAACAAGTCAGTACACGCTTGGTAACTCTGAA
TTACTGCTTATGTCGGATGTTAGCGGAACCTCATTTGATGCCCGTTATTTTGGGCCTGTTAATCGTTCTC
AAGTGAAAGCGGTTATTCGTCCAGTATTCACTTGGTAA
 Primer design