SecReT4
Protein ID: 253723648
T4SS name [ID]Trb [57]
Gene symbolTraG
Locus tagpP9014_p09
StrainPhotobacterium damselae subsp. piscicida plasmid pP9014 (NC_012919)
Repliconplasmid pP9014 [GenBank: NC_012919] [Browse all T4SS(s) in this replicon]
Location [Strand]10793..12697 [-]
ProductTraG conjugal transfer protein
Component typeTraG
UniProt IDC5NNB7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 5.3e-154, Aligned region: 121..612
TraG-D_C [PF12696], Evalue: 1.2e-31, Aligned region: 444..568
TrwB_AAD_bind [PF10412], Evalue: 6.6e-25, Aligned region: 194..568
Protein Sequence: 634 a.a.     [Download]
>gi|253723648|ref|YP_003023934.1| TraG conjugal transfer protein [Photobacterium damselae subsp. piscicida]
MNPKINNAVGPQVRAKKTSKNRTLPALGAVSIAVGLQSATQYFAHSFNYQESLGANINNVYAPWKILNWA
SDWYSNYPNQFMEAASVGMVVTSVGLLGVTITKVVTNNSSKANEYLHGSARWAGKKDIQSAGLLPRNRNL
LEVVTGKDAPSSTGVYVGGWEDEEGNFYYLRHNGPEHVLTYAPTRSGKGVGLVVPTLLSWAQSAVITDLK
GELWALTAGWRQQYANNKVLRFEPASNYGGIHWNPLDEIRIGTEYEVGDVQNLATLIVDPDGKGMESHWQ
KTAFALLVGVILHALYKAKNEGTPATLPAVDAMLADPERDTGELWMEMATYGHVDGQNHPAVGSAARDMM
DRPEEEGGSVLSTAKSYLALYRDPVVARNVSESEFKIRDLMNHDNPVSLYIVTQPNDKARLRPLVRILVN
MIIRLLADEMTFEKGRPVAHYKHRLLAMLDEFPSLGKLEILQESLAFVAGYGIKCYLICQDLNQLKSRET
GYGPDETITSNCHVQNAYPPNRIETAEHLSRLTGQTTVVKEQITTSGRRTSALLGQVSRTIQEVQRPLLT
PDECLRMPGPVKNAKGDIDTAGDMVVYVAGYPAVYGKQPLYFKDPIFLARAQIEAPKVCDKLRVVEQVEE
GIQI
 
Nucleotide Sequence: 1905 bp     [Download]
>gi|253723639|ref|NC_012919.1|:c12697-10793 Photobacterium damselae subsp. piscicida plasmid pP9014 DNA, complete sequence
ATGAATCCAAAAATAAACAATGCAGTTGGTCCTCAAGTCAGGGCAAAAAAAACAAGCAAAAATCGCACAT
TGCCCGCTTTGGGAGCCGTGTCGATTGCTGTTGGCTTACAGTCAGCGACCCAATACTTTGCACACTCTTT
TAATTATCAAGAGTCGCTAGGGGCAAATATTAATAATGTATACGCACCCTGGAAAATTTTAAATTGGGCG
AGTGATTGGTATAGCAATTACCCCAATCAGTTTATGGAAGCGGCCAGCGTTGGGATGGTTGTGACTTCGG
TTGGTCTGTTGGGTGTGACTATCACAAAGGTAGTCACCAATAACAGCTCAAAAGCAAATGAATATTTGCA
TGGTTCCGCACGTTGGGCGGGTAAGAAAGATATTCAATCTGCGGGTTTATTACCTCGTAACCGTAATCTG
TTGGAAGTTGTGACAGGTAAAGACGCACCAAGCTCAACGGGTGTTTATGTTGGGGGTTGGGAAGATGAAG
AAGGAAACTTTTACTACCTGCGCCACAATGGTCCAGAACACGTTTTAACATATGCGCCAACACGTTCGGG
TAAAGGTGTCGGTCTTGTTGTTCCTACATTGCTTTCCTGGGCGCAAAGTGCCGTGATTACAGACCTTAAA
GGAGAACTTTGGGCTTTGACTGCGGGCTGGCGTCAGCAGTACGCAAACAATAAAGTTTTGCGTTTTGAGC
CTGCATCAAATTACGGCGGTATTCATTGGAACCCGTTAGACGAAATCCGAATAGGCACTGAATACGAAGT
AGGGGACGTTCAAAACTTAGCAACGCTGATTGTAGACCCCGATGGTAAAGGCATGGAATCACACTGGCAA
AAAACCGCCTTTGCACTTTTGGTTGGTGTAATTCTACATGCTTTATACAAAGCTAAAAACGAAGGGACAC
CCGCGACCCTTCCTGCGGTTGATGCAATGCTTGCTGACCCTGAGCGCGACACAGGCGAACTTTGGATGGA
AATGGCTACCTATGGTCATGTGGACGGTCAAAACCACCCTGCGGTTGGTTCTGCTGCGCGTGACATGATG
GATAGACCAGAGGAAGAAGGTGGCTCTGTTCTATCGACCGCAAAATCATATCTAGCTCTTTACCGCGATC
CAGTGGTAGCTCGAAACGTGAGTGAGTCTGAGTTCAAGATTAGAGATCTGATGAACCATGATAACCCTGT
CAGCCTTTACATTGTTACGCAACCAAATGATAAAGCCCGTTTGCGCCCATTGGTCCGAATATTGGTAAAC
ATGATCATTCGCCTGTTGGCTGATGAAATGACGTTTGAGAAAGGCCGACCTGTAGCCCATTACAAACACA
GACTGTTGGCGATGCTGGACGAGTTCCCAAGTTTAGGGAAGCTAGAAATATTGCAAGAATCACTAGCTTT
CGTTGCGGGCTATGGGATTAAGTGTTACTTGATTTGCCAGGACTTAAACCAACTTAAAAGCCGTGAAACA
GGTTATGGCCCTGATGAAACCATCACATCTAACTGTCACGTTCAGAACGCATACCCGCCAAACCGAATCG
AAACCGCCGAACACTTGTCTCGATTAACGGGCCAAACAACTGTAGTAAAAGAGCAGATTACAACCAGTGG
GCGCCGTACTTCTGCGCTACTAGGGCAAGTATCTCGAACTATTCAAGAAGTACAACGACCGTTGTTAACG
CCAGACGAATGTTTGCGTATGCCTGGGCCAGTTAAAAACGCCAAGGGTGATATTGATACCGCGGGCGATA
TGGTTGTGTATGTCGCGGGTTATCCCGCGGTTTATGGCAAACAACCTCTTTACTTCAAAGACCCTATTTT
TCTTGCTCGCGCCCAAATTGAAGCGCCTAAAGTTTGCGATAAGTTACGAGTCGTCGAGCAAGTAGAGGAA
GGGATTCAAATATGA
 Primer design