SecReT4
Protein ID: 253723668
T4SS name [ID]Trb [57]
Gene symbolTrbB
Locus tagpP9014_p29
StrainPhotobacterium damselae subsp. piscicida plasmid pP9014 (NC_012919)
Repliconplasmid pP9014 [GenBank: NC_012919] [Browse all T4SS(s) in this replicon]
Location [Strand]28002..28991 [+]
ProductTrbB protein
Component typeTrbB
UniProt IDC5NND7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 6.3e-73, Aligned region: 26..295
IstB_IS21 [PF01695], Evalue: 8.7e-06, Aligned region: 145..189
ResIII [PF04851], Evalue: 1.3e-05, Aligned region: 62..205
FtsK_SpoIIIE [PF01580], Evalue: 1.3e-05, Aligned region: 147..181
AAA_10 [PF12846], Evalue: 3.4e-05, Aligned region: 152..189
Zeta_toxin [PF06414], Evalue: 4.1e-05, Aligned region: 148..214
DEAD [PF00270], Evalue: 4.1e-05, Aligned region: 136..204
PhoH [PF02562], Evalue: 8.3e-05, Aligned region: 136..191
Protein Sequence: 329 a.a.     [Download]
>gi|253723668|ref|YP_003023954.1| TrbB protein [Photobacterium damselae subsp. piscicida]
MQPNESTGSVKDRAKRKLERDMGSELLAIFNDPKTVELMLNPDGTVWVEKLGEDMQCITTLRPAQGRAII
ETVAGFHGKEVTSYTPNLEAEFPLDGSRFAGQLETVAVGQGPSFAIRKKAVSIFTLEQYVENGIMTAAQK
DSLVNIISQKKNILVVGGTGSGKTTLANAIIRETVEQFPNDRFIIIEDTSEIQCAAKNYVQYRTSETVDM
TSLLKTALRMRPDRILVGEVRGPEALDLLMAWNTGHPGGVATIHANKGPSSGLGRFKFLITMHPKKPDPI
EPFIGEAVHALVYIAKNKKTNTRAVEEIIEVSGYQDGQYVTETLSNKPI
 
Nucleotide Sequence: 990 bp     [Download]
>gi|253723639|ref|NC_012919.1|:28002-28991 Photobacterium damselae subsp. piscicida plasmid pP9014 DNA, complete sequence
ATGCAACCTAACGAATCGACAGGCTCAGTAAAAGACAGAGCAAAAAGAAAGCTAGAAAGGGACATGGGTT
CTGAACTACTAGCAATCTTTAATGATCCAAAAACCGTAGAGTTGATGCTCAATCCTGACGGCACAGTTTG
GGTTGAAAAGCTAGGTGAAGATATGCAGTGCATCACCACACTTAGACCAGCTCAAGGCCGAGCTATTATC
GAAACCGTAGCAGGTTTTCATGGCAAAGAAGTTACTTCATACACTCCGAATTTAGAGGCTGAATTTCCCT
TAGATGGTTCTCGCTTTGCAGGGCAACTAGAGACTGTGGCAGTAGGTCAGGGTCCGTCATTTGCCATACG
TAAAAAAGCGGTGAGCATATTCACGCTTGAACAGTATGTAGAAAACGGAATTATGACTGCCGCTCAAAAA
GATTCTTTAGTGAATATCATTTCACAAAAGAAAAACATTCTTGTCGTGGGGGGGACTGGTTCCGGTAAAA
CCACACTGGCAAACGCCATTATTCGTGAAACCGTCGAACAGTTCCCTAATGACCGCTTCATCATCATTGA
AGACACCAGTGAAATTCAGTGTGCCGCGAAGAACTATGTTCAGTACCGCACCTCTGAAACCGTCGATATG
ACCAGCTTATTAAAAACCGCATTAAGGATGCGACCTGACCGAATTCTAGTCGGTGAGGTGCGTGGTCCAG
AAGCTCTCGATTTGTTAATGGCTTGGAATACAGGTCATCCAGGTGGCGTTGCCACAATACATGCGAACAA
AGGCCCTTCTAGTGGTCTTGGGAGGTTTAAGTTCCTTATAACAATGCACCCTAAAAAACCAGACCCAATT
GAACCGTTTATAGGCGAGGCGGTTCATGCGTTGGTGTACATCGCCAAAAACAAAAAAACCAACACTAGGG
CCGTCGAAGAAATTATCGAAGTGTCCGGTTATCAAGATGGTCAATACGTGACCGAAACCTTATCAAACAA
ACCTATCTAG
 Primer design