SecReT4
Protein ID: 253723669
T4SS name [ID]Trb [57]
Gene symbolTrbC
Locus tagpP9014_p30
StrainPhotobacterium damselae subsp. piscicida plasmid pP9014 (NC_012919)
Repliconplasmid pP9014 [GenBank: NC_012919] [Browse all T4SS(s) in this replicon]
Location [Strand]29003..29428 [+]
ProductTrbC conjugal transfer protein precursor
Component typeTrbC
UniProt IDC5NND8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 7.5e-18, Aligned region: 14..109
Protein Sequence: 141 a.a.     [Download]
>gi|253723669|ref|YP_003023955.1| TrbC conjugal transfer protein precursor [Photobacterium damselae subsp. piscicida]
MQFSLSKIRFDRSSMFYLGLFALMFLAMALQPAMASEGTGGSLPYESWLTNLRNSVTGPVAFALSMIGIV
VAGGILIFGGELNAFFRTLIFLVLVMAMLVGAQNMMSTFFGRGAELAALSEAVINQVGGAASRVVNGVQA
A
 
Nucleotide Sequence: 426 bp     [Download]
>gi|253723639|ref|NC_012919.1|:29003-29428 Photobacterium damselae subsp. piscicida plasmid pP9014 DNA, complete sequence
ATGCAATTCTCTCTATCAAAAATCCGATTCGACCGCTCGTCTATGTTCTACCTGGGCTTGTTTGCGTTGA
TGTTCTTAGCAATGGCGCTTCAACCTGCAATGGCATCCGAAGGCACTGGCGGCTCACTTCCTTATGAGAG
CTGGCTAACTAACCTTCGTAACTCTGTTACTGGTCCTGTGGCGTTCGCTCTTTCAATGATTGGTATCGTT
GTTGCGGGCGGTATTTTGATCTTCGGTGGTGAACTAAACGCCTTCTTCCGCACACTGATTTTCCTTGTTT
TGGTAATGGCAATGCTTGTAGGTGCGCAAAACATGATGTCTACGTTCTTCGGTCGTGGTGCTGAACTTGC
TGCGCTTAGCGAAGCTGTTATTAACCAAGTTGGCGGCGCGGCTTCTCGTGTTGTTAACGGTGTACAGGCG
GCTTAA
 Primer design