SecReT4
Protein ID: 253723670
T4SS name [ID]Trb [57]
Gene symbolTrbD
Locus tagpP9014_p31
StrainPhotobacterium damselae subsp. piscicida plasmid pP9014 (NC_012919)
Repliconplasmid pP9014 [GenBank: NC_012919] [Browse all T4SS(s) in this replicon]
Location [Strand]29431..29742 [+]
ProductTrbD mating pair formation protein
Component typeTrbD
UniProt IDC5NND9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 4.3e-25, Aligned region: 1..87
Protein Sequence: 103 a.a.     [Download]
>gi|253723670|ref|YP_003023956.1| TrbD mating pair formation protein [Photobacterium damselae subsp. piscicida]
MALRTIPIRRAGNRANLFMGGDRELVMFSGLLAAALIFSAQEIRATVFGICLWWGALFVCRLMAKSDPKL
RHVYLRHRIYKAYYPARSTPFRENTSGQGKQYK
 
Nucleotide Sequence: 312 bp     [Download]
>gi|253723639|ref|NC_012919.1|:29431-29742 Photobacterium damselae subsp. piscicida plasmid pP9014 DNA, complete sequence
ATGGCTTTGCGCACGATCCCCATTCGTAGGGCTGGCAACAGAGCGAACTTGTTCATGGGCGGGGATCGTG
AGCTTGTGATGTTCTCTGGTTTGCTCGCTGCCGCACTAATTTTTAGTGCTCAAGAAATTAGAGCAACTGT
ATTCGGTATTTGTCTTTGGTGGGGTGCGCTTTTTGTGTGCCGACTAATGGCTAAATCAGATCCTAAATTG
CGTCATGTGTATCTGAGACACCGCATATACAAAGCGTACTACCCAGCACGTAGTACGCCCTTCCGTGAAA
ATACATCAGGCCAAGGGAAGCAATACAAATGA
 Primer design