SecReT4
Protein ID: 253723671
T4SS name [ID]Trb [57]
Gene symbolTrbE
Locus tagpP9014_p32
StrainPhotobacterium damselae subsp. piscicida plasmid pP9014 (NC_012919)
Repliconplasmid pP9014 [GenBank: NC_012919] [Browse all T4SS(s) in this replicon]
Location [Strand]29742..32279 [+]
ProductTrbE protein
Component typeTrbE
UniProt IDC5NNE0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 4.2e-52, Aligned region: 219..431
AAA_10 [PF12846], Evalue: 7.7e-34, Aligned region: 489..765
Protein Sequence: 845 a.a.     [Download]
>gi|253723671|ref|YP_003023957.1| TrbE protein [Photobacterium damselae subsp. piscicida]
MIQSISFAIAGFGALLLLILFSRVRAVDAELKLKKHRSKDAGLADLLNYAAVVDDGVVVCKNGAFMASWL
YKGEDNASSTDAQREMVSFRINQALSGLGSGWMVHVDAVRRPSPKYSDRNLSEFPDKISAAIDEERRQLF
EGLGTMYEGYFVLTLTWFPPVLAQRKFVELMFDDDAEIVGKKEQTKGLINQFKREITAIENRLSSAVNLS
RLRGNKITNEDGKTITHDDFLGWLQFCITGLNHPVTLPSNPMYLDAYLGGQEMWGGVVPKVGRKFVQVVA
IEGFPMESYPGVLSALAELPVEYRWSSRFIFMDQHESLRHLDKFRKKWRQKIRGFFDQVFNTNNGTVDQD
ALSMVQDAEAAIAEISSGVVAAGYYTSVVVLMDENRDRLEQSARQVEKSVNRLGFAARTETINTLDAYLG
SLPGHGVENVRRPLINTMNLADLLPTSTVWTGSNKAPCPMYPSLAPALMNCVTSGSTPFRLNLHVRDLGH
TFMFGPTGAGKSTHLALIAAQLRRYKGMSIYAFDKGMSMYPLTKAVNGLHFSVGADDDRLAFCPLQFLDS
KSDRAWAMEWIDTILALNGVNTTPAQRNEIGNAIQSMYESGARTLSEFSLTIQDENIREAMRQYTVDGAM
GHLLDSEQDGLSLTDFTTFEIEELMNLGEKFALPVLLYLFRRIECSLKGQPSVIILDEAWLMLGHPAFRE
KIREWLKVLRKANCLVLMATQSLSDAANSGILDVIVESTATKIFLPNVYARDEDTAALYRRMGLNSRQID
ILATAVPKRQYYYVSENGRRLYDLALGPLALSFVGASDKESVAIIKQLEAKHGETWVDEWLASRGININN
YLEAA
 
Nucleotide Sequence: 2538 bp     [Download]
>gi|253723639|ref|NC_012919.1|:29742-32279 Photobacterium damselae subsp. piscicida plasmid pP9014 DNA, complete sequence
ATGATTCAATCTATTTCATTCGCCATTGCTGGCTTCGGTGCTTTGTTGTTACTAATCCTATTCTCCCGTG
TCCGTGCGGTTGATGCTGAATTGAAACTCAAAAAGCATCGCTCTAAAGATGCAGGATTGGCTGATTTACT
TAACTACGCTGCCGTTGTCGATGATGGTGTAGTGGTATGTAAAAACGGCGCATTTATGGCGTCATGGCTT
TACAAAGGAGAGGACAACGCAAGTAGTACCGATGCACAACGAGAAATGGTGTCCTTTCGTATAAATCAGG
CGCTTTCTGGTTTGGGTAGTGGTTGGATGGTTCACGTTGATGCTGTACGCCGTCCATCACCAAAATATTC
AGATCGTAATTTATCTGAGTTTCCAGACAAGATTTCAGCTGCTATTGACGAAGAACGCCGCCAACTATTC
GAAGGGTTGGGAACTATGTATGAGGGCTATTTTGTGCTCACTTTAACCTGGTTTCCTCCAGTATTGGCTC
AGCGAAAGTTTGTTGAACTTATGTTTGATGACGATGCGGAAATTGTTGGTAAGAAAGAACAAACAAAGGG
CCTGATTAATCAGTTCAAGCGTGAAATAACCGCTATTGAAAACCGTCTATCCAGCGCTGTTAATCTGAGT
CGTTTGCGTGGTAACAAAATTACAAATGAAGATGGAAAAACCATCACTCACGATGATTTCTTGGGGTGGT
TACAGTTCTGTATTACGGGCCTTAATCATCCAGTGACATTGCCTAGCAATCCTATGTATTTGGATGCGTA
CTTAGGCGGTCAAGAAATGTGGGGGGGTGTTGTTCCTAAAGTCGGTCGTAAATTTGTTCAGGTCGTAGCG
ATTGAAGGTTTTCCTATGGAGTCATATCCAGGAGTGCTTTCTGCTCTTGCTGAATTGCCTGTTGAATATC
GCTGGTCATCACGATTCATATTCATGGACCAACACGAATCACTAAGACATTTAGACAAGTTCCGTAAAAA
GTGGCGCCAGAAGATTAGAGGTTTCTTTGATCAGGTTTTCAACACTAATAACGGCACTGTAGATCAAGAT
GCACTATCAATGGTTCAAGATGCAGAGGCCGCAATTGCTGAAATCAGTAGTGGTGTTGTAGCTGCGGGTT
ATTACACAAGCGTTGTCGTCCTAATGGATGAAAACCGCGACCGACTAGAACAGTCTGCCCGCCAAGTAGA
AAAGTCAGTAAACCGTCTTGGTTTCGCAGCTCGTACAGAAACTATCAATACTCTGGATGCTTACTTGGGA
AGCCTGCCAGGTCACGGTGTCGAAAACGTTCGTCGTCCACTAATTAACACTATGAATCTGGCCGACTTGC
TTCCAACAAGCACTGTTTGGACTGGTTCAAATAAGGCTCCTTGCCCAATGTATCCATCATTGGCGCCAGC
ACTAATGAACTGTGTAACAAGTGGTTCTACTCCGTTTAGGTTAAACCTGCACGTTCGAGATTTGGGGCAC
ACTTTTATGTTTGGTCCAACAGGGGCGGGTAAATCAACGCACTTGGCATTAATCGCAGCTCAGCTGCGCA
GATACAAAGGCATGTCTATTTATGCTTTCGACAAGGGTATGTCTATGTACCCATTAACAAAGGCTGTCAA
TGGATTACATTTTTCTGTTGGTGCAGACGATGACCGCCTAGCGTTCTGTCCATTGCAATTCTTAGATAGC
AAATCAGATCGCGCATGGGCGATGGAATGGATTGATACCATTTTGGCGTTAAACGGGGTTAATACCACTC
CAGCTCAACGTAACGAGATTGGTAACGCAATCCAAAGTATGTACGAAAGCGGTGCGCGTACACTGTCTGA
GTTCTCCTTAACAATCCAGGATGAAAATATCCGTGAAGCGATGCGCCAATACACAGTAGATGGGGCTATG
GGTCATCTATTGGACTCTGAACAAGATGGATTGTCTTTAACGGATTTCACAACATTTGAAATCGAAGAAT
TGATGAACCTGGGCGAGAAGTTCGCACTGCCAGTATTGCTTTACCTATTCCGTCGTATCGAGTGCAGCCT
GAAAGGTCAACCGTCCGTCATTATTTTAGATGAAGCATGGCTAATGCTAGGGCATCCAGCTTTCCGTGAA
AAAATTCGAGAATGGCTCAAAGTTCTTCGTAAGGCGAATTGTCTGGTTCTTATGGCAACACAAAGTCTGT
CTGATGCGGCCAACTCTGGAATCCTAGACGTTATTGTCGAGTCTACTGCAACCAAAATCTTTCTTCCTAA
CGTGTATGCGCGTGATGAAGATACAGCGGCTCTTTATCGTCGAATGGGCCTCAATAGCCGTCAAATCGAC
ATTTTGGCAACCGCGGTTCCTAAACGTCAATACTATTATGTTTCGGAAAATGGGCGCCGTCTCTATGACT
TAGCTCTTGGCCCGCTTGCATTGTCGTTTGTAGGGGCTTCTGACAAGGAATCTGTAGCAATCATTAAACA
GCTTGAAGCTAAGCATGGTGAAACGTGGGTTGATGAATGGTTAGCAAGCAGAGGCATAAATATTAATAAC
TACTTGGAGGCCGCGTAA
 Primer design