SecReT4
Protein ID: 253723672
T4SS name [ID]Trb [57]
Gene symbolTrbF
Locus tagpP9014_p33
StrainPhotobacterium damselae subsp. piscicida plasmid pP9014 (NC_012919)
Repliconplasmid pP9014 [GenBank: NC_012919] [Browse all T4SS(s) in this replicon]
Location [Strand]32279..33055 [+]
ProductTrbF protein
Component typeTrbF
UniProt IDC5NNE1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 4.9e-53, Aligned region: 45..256
Protein Sequence: 258 a.a.     [Download]
>gi|253723672|ref|YP_003023958.1| TrbF protein [Photobacterium damselae subsp. piscicida]
MSFSDTLKGLIFKNPAPGYQSEPTVEKEEKQGKRQEETENPYLTARRTWNEHVGSVVSAKQTWQVVGILS
LLITLAAVGGVIHIGSQSKFVPYVVEVDSLGQAQAAGPVTASSMADPRVMGSTVSKFIENARLVSPDVAL
QRKAVFGVYAHLSPKDSATIKMNEWLNGSADSSPFKRAAKVMVSIDIKSVMPQTPTTWQVDWVETVRDRQ
GVKQGEPALMRALVTVYTADTSTQTTEEQMRNNPLGIYVRDFSWSRLQ
 
Nucleotide Sequence: 777 bp     [Download]
>gi|253723639|ref|NC_012919.1|:32279-33055 Photobacterium damselae subsp. piscicida plasmid pP9014 DNA, complete sequence
ATGAGCTTTTCCGACACACTAAAGGGGCTGATTTTCAAAAATCCCGCGCCAGGTTATCAATCAGAACCGA
CCGTTGAGAAAGAAGAAAAACAGGGTAAACGCCAAGAAGAAACTGAAAACCCTTATCTGACTGCCCGCCG
TACTTGGAATGAACATGTGGGTTCAGTGGTTTCAGCAAAGCAGACCTGGCAGGTTGTGGGGATCTTGTCC
CTGCTAATTACGTTGGCCGCTGTTGGTGGTGTGATTCACATTGGTAGTCAATCAAAGTTCGTCCCTTACG
TAGTTGAAGTGGACAGCTTAGGTCAGGCTCAAGCAGCAGGACCCGTCACAGCTTCTTCAATGGCTGACCC
GCGAGTTATGGGTTCGACGGTTTCAAAATTTATTGAAAATGCTCGCTTGGTGTCTCCAGACGTAGCTTTG
CAACGTAAAGCTGTTTTTGGTGTTTACGCCCATTTATCACCGAAAGATTCAGCGACCATAAAAATGAATG
AATGGCTAAACGGTAGTGCGGATTCAAGTCCATTCAAACGTGCCGCGAAGGTAATGGTAAGTATTGATAT
TAAATCAGTCATGCCGCAAACACCGACAACGTGGCAAGTCGATTGGGTGGAAACAGTACGAGACCGACAA
GGTGTTAAACAAGGTGAACCCGCTCTAATGCGCGCATTAGTTACTGTTTACACCGCAGATACTTCAACGC
AGACCACAGAAGAACAGATGCGCAATAACCCGCTGGGTATTTACGTTCGTGACTTCTCTTGGTCACGCCT
GCAATGA
 Primer design