SecReT4
Protein ID: 253723673
T4SS name [ID]Trb [57]
Gene symbolTrbG
Locus tagpP9014_p34
StrainPhotobacterium damselae subsp. piscicida plasmid pP9014 (NC_012919)
Repliconplasmid pP9014 [GenBank: NC_012919] [Browse all T4SS(s) in this replicon]
Location [Strand]33073..33978 [+]
ProductTrbG mating pair formation protein
Component typeTrbG
UniProt IDC5NNE2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.9e-64, Aligned region: 74..299
Protein Sequence: 301 a.a.     [Download]
>gi|253723673|ref|YP_003023959.1| TrbG mating pair formation protein [Photobacterium damselae subsp. piscicida]
MNKQLSAVILGTALLVPSLAKIANANGLEDKYFSNNNPTLTQQERQALAIAKKWQAGNGNGGIRPFSGRN
GSIQYVFGAQSPSVVCAVLQVCDIALQPGEYVNSIQLGDTARWNVEPAISGTGAAETQHLLIKPLDVGLE
TSLVVTTDRRVYHIRLRSHRKEYMPQVSFTYPEDALAKWETIRTRERQHREDNTIPSTREYLGDLSFDYQ
VSGSAAWKPVRVFNDGHKTIIQMPKAMQQADAPTLLVVRNDGGWFSDAETEMVNYRVQGDRYIVDTVFKK
AILISGVGSRQDKITITKEGK
 
Nucleotide Sequence: 906 bp     [Download]
>gi|253723639|ref|NC_012919.1|:33073-33978 Photobacterium damselae subsp. piscicida plasmid pP9014 DNA, complete sequence
ATGAACAAGCAATTATCAGCTGTAATTCTTGGCACTGCGCTGTTAGTGCCTTCTCTAGCAAAAATCGCCA
ATGCGAACGGTCTAGAAGATAAATATTTTTCAAACAATAACCCGACTTTAACGCAACAAGAACGCCAAGC
ATTGGCTATTGCCAAAAAGTGGCAAGCGGGAAATGGTAACGGGGGTATTCGCCCGTTCTCTGGCCGTAAC
GGTTCGATACAGTATGTATTTGGAGCGCAATCACCAAGTGTTGTATGTGCTGTTCTGCAAGTTTGTGATA
TTGCCTTACAACCAGGTGAATACGTCAATTCAATTCAGTTAGGTGATACCGCTCGTTGGAATGTCGAACC
AGCAATTTCCGGTACGGGTGCAGCGGAAACACAACACTTGTTAATTAAACCGTTGGATGTGGGCCTAGAA
ACAAGTCTAGTCGTCACTACAGACCGCCGTGTTTACCACATTCGCTTGCGTTCACACCGCAAAGAGTACA
TGCCTCAAGTGTCTTTCACATATCCCGAAGATGCTTTAGCTAAATGGGAAACAATTCGAACCCGTGAACG
TCAACATCGAGAAGATAATACGATCCCTTCTACGCGAGAATACCTGGGCGATTTGTCTTTTGATTATCAA
GTTTCTGGCTCAGCCGCTTGGAAGCCTGTTCGTGTGTTCAATGACGGTCACAAGACCATCATTCAAATGC
CAAAGGCAATGCAACAGGCAGACGCACCAACGTTATTAGTTGTTCGAAATGATGGCGGTTGGTTCAGTGA
TGCTGAAACCGAAATGGTTAACTATCGAGTTCAAGGAGATCGTTACATCGTTGATACGGTGTTTAAGAAA
GCGATTCTTATCTCTGGTGTTGGTAGCCGTCAAGACAAAATCACTATTACCAAAGAGGGCAAATAG
 Primer design