SecReT4
Protein ID: 253723674
T4SS name [ID]Trb [57]
Gene symbolTrbH
Locus tagpP9014_p35
StrainPhotobacterium damselae subsp. piscicida plasmid pP9014 (NC_012919)
Repliconplasmid pP9014 [GenBank: NC_012919] [Browse all T4SS(s) in this replicon]
Location [Strand]33981..34481 [+]
ProductTrbH protein
Component typeTrbH
UniProt IDC5NNA1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbH [PF07283], Evalue: 6.6e-42, Aligned region: 33..166
Protein Sequence: 166 a.a.     [Download]
>gi|253723674|ref|YP_003023960.1| TrbH protein [Photobacterium damselae subsp. piscicida]
MRKLLATAIFSLALVGCASHTPYGNFVENPTGLNQQKIANDTIEQITSLYPPAKTRFEIKQATPDAFGTA
LVRGLRDKGYALLEFDPETAKAAQRTSSRPNESAPEVKVKTPVQQGFGLPIYYVFDQFSGTNMYRVTVMV
GNESITRPYAQENGTVVPMGYWVRKE
 
Nucleotide Sequence: 501 bp     [Download]
>gi|253723639|ref|NC_012919.1|:33981-34481 Photobacterium damselae subsp. piscicida plasmid pP9014 DNA, complete sequence
ATGCGTAAATTACTTGCCACAGCAATTTTTTCCCTAGCCTTGGTAGGGTGTGCATCGCACACCCCTTATG
GGAACTTTGTAGAAAATCCAACCGGATTGAATCAACAAAAAATAGCAAACGATACTATTGAACAAATCAC
ATCATTGTATCCACCTGCTAAGACTCGTTTTGAGATAAAACAAGCGACTCCTGATGCTTTTGGTACGGCT
TTAGTTCGAGGGCTGAGAGATAAAGGTTACGCCCTCTTGGAGTTTGACCCTGAAACCGCTAAAGCGGCTC
AAAGAACGTCCTCGCGACCTAATGAGTCAGCGCCAGAAGTAAAGGTAAAAACACCTGTTCAGCAAGGTTT
TGGCCTGCCTATCTATTACGTGTTTGATCAGTTCTCTGGCACAAATATGTACCGAGTAACCGTCATGGTA
GGCAATGAATCAATCACTCGTCCCTACGCCCAAGAAAACGGCACTGTTGTTCCTATGGGTTATTGGGTCC
GTAAGGAGTAG
 Primer design