SecReT4
Protein ID: 253723675
T4SS name [ID]Trb [57]
Gene symbolTrbI
Locus tagpP9014_p36
StrainPhotobacterium damselae subsp. piscicida plasmid pP9014 (NC_012919)
Repliconplasmid pP9014 [GenBank: NC_012919] [Browse all T4SS(s) in this replicon]
Location [Strand]34488..35909 [+]
ProductTrbI protein
Component typeTrbI
UniProt IDC5NNA2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 7.4e-66, Aligned region: 279..464
Protein Sequence: 473 a.a.     [Download]
>gi|253723675|ref|YP_003023961.1| TrbI protein [Photobacterium damselae subsp. piscicida]
MSDKNDQMSPDASPGDMSKKTGVRRVNNRPVMILGGVLGSFLLVMMLVAADRSEQQNAPAEGQKEFAGNT
SMFADEIAGTQEDGFIPAAQPPVIPDLEAGVQESEESTAESTASTTAVTVARPANPDLPPTPPQNPTLNS
PEMDDEAQRIRMAKLQMLQEAVSARTGVQAVAPRSSNSAPAPGSRPETRKEMLAEIARVRSQTASLRSTD
PNAVYQEGLAQAQNRNRGGGFGGSSSNSAPMLMQTSAQGGANGYGEFDSNGGDRWQLNSQMQAPRTPFEL
RAGFVIPATLISGINSDLPGQIMAQVSQNVSDTATGSHLLIPQGSRLIGSYSSDVAYGQERVLVAWQRII
FPDGKAMDIGSMPGADSAGYSGFHDQVNNHYVRIFGSAFLMSGITAGITLSQDNDNSSDGNDRQRASDAL
SEALGQQLGQVAVEMIRKNMNIAPTLEIRPGYRFNVIVTKDMTFSKPYSSFDY
 
Nucleotide Sequence: 1422 bp     [Download]
>gi|253723639|ref|NC_012919.1|:34488-35909 Photobacterium damselae subsp. piscicida plasmid pP9014 DNA, complete sequence
ATGAGCGATAAAAACGATCAAATGTCTCCTGACGCTTCACCTGGTGACATGTCAAAAAAAACAGGCGTTC
GCCGTGTTAATAATCGCCCAGTGATGATTCTTGGCGGTGTGCTTGGCTCTTTTTTACTGGTAATGATGCT
AGTTGCCGCAGACCGTTCTGAGCAGCAGAATGCGCCAGCAGAAGGACAAAAAGAGTTTGCGGGCAATACA
TCAATGTTTGCCGATGAAATTGCAGGCACTCAAGAGGATGGTTTTATTCCCGCGGCACAGCCTCCTGTAA
TACCTGATTTAGAGGCGGGCGTTCAAGAATCGGAAGAAAGTACAGCTGAAAGCACAGCCAGCACAACCGC
CGTTACGGTAGCTCGTCCAGCTAATCCAGACTTGCCACCAACGCCACCGCAAAACCCAACGCTAAATAGT
CCAGAAATGGATGATGAAGCCCAGCGTATCCGTATGGCTAAGCTACAAATGCTACAAGAAGCTGTCAGCG
CAAGAACAGGCGTTCAGGCGGTAGCTCCGCGCAGCAGTAATTCAGCCCCGGCTCCAGGTTCTCGCCCTGA
GACTCGTAAAGAAATGCTCGCAGAAATTGCGCGTGTTCGTAGTCAAACGGCATCGCTCCGAAGCACTGAC
CCTAATGCAGTGTACCAAGAAGGATTAGCCCAAGCTCAGAATAGGAATAGAGGCGGCGGTTTTGGTGGCA
GTTCATCAAACAGTGCGCCAATGCTCATGCAAACGTCAGCTCAAGGTGGTGCTAATGGATACGGAGAGTT
TGATAGTAATGGCGGCGACCGTTGGCAGCTTAATTCACAAATGCAGGCGCCTCGTACACCTTTCGAGCTA
AGAGCTGGCTTCGTAATTCCTGCCACGCTTATTTCAGGTATCAACTCAGATCTTCCAGGTCAGATTATGG
CCCAAGTGTCTCAGAACGTTTCCGATACCGCGACAGGGAGTCACTTGTTGATTCCGCAGGGTTCTCGCCT
CATTGGTTCTTATTCTAGCGATGTAGCTTACGGACAAGAGCGCGTGTTAGTTGCTTGGCAACGGATCATC
TTTCCCGATGGTAAAGCAATGGATATCGGATCAATGCCAGGCGCGGATTCAGCAGGTTATTCAGGTTTCC
ACGACCAAGTAAATAACCACTATGTGCGTATCTTTGGTTCGGCTTTCTTAATGTCAGGTATCACAGCAGG
TATCACATTAAGCCAGGACAACGACAACAGCAGCGATGGTAACGACCGTCAACGTGCAAGTGATGCGCTA
AGTGAAGCTCTAGGCCAGCAGCTAGGACAAGTAGCTGTAGAGATGATCAGAAAAAATATGAATATTGCGC
CGACTTTGGAAATTCGTCCTGGTTATCGCTTCAACGTAATTGTTACCAAAGACATGACTTTTTCTAAGCC
ATACAGCTCATTTGATTACTAA
 Primer design