SecReT4
Protein ID: 253723676
T4SS name [ID]Trb [57]
Gene symbolTrbJ
Locus tagpP9014_p37
StrainPhotobacterium damselae subsp. piscicida plasmid pP9014 (NC_012919)
Repliconplasmid pP9014 [GenBank: NC_012919] [Browse all T4SS(s) in this replicon]
Location [Strand]35927..36709 [+]
ProductTrbJ protein of DNA transfer system
Component typeTrbJ
UniProt IDC5NNA3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 260 a.a.     [Download]
>gi|253723676|ref|YP_003023962.1| TrbJ protein of DNA transfer system [Photobacterium damselae subsp. piscicida]
MKTKGRILAAKTVLVVAMATGSVATLITQPVQAGIPVIDGGNLAQNIVTAMQAAAQTAKQIEQYRTQLSQ
YENMLQNSLAPAAYIWDQAQSTINGLVQATNTLQYYQNQLGSLDRYLGKFQDVAYYRSSPCFSNSGCSEA
EWSAMNENRRLASESQKKANDALFKGLEKQQDNIKDDARQLQRLQSTAQGAQGQLEAIGYANQLASNQTN
QLLQIRSLLIAQQNAVATRMQVVADREAQHQASAEQLRKGSYTPSPARTW
 
Nucleotide Sequence: 783 bp     [Download]
>gi|253723639|ref|NC_012919.1|:35927-36709 Photobacterium damselae subsp. piscicida plasmid pP9014 DNA, complete sequence
ATGAAAACAAAAGGAAGAATTTTAGCCGCTAAAACTGTGCTGGTTGTCGCAATGGCAACGGGCTCGGTCG
CTACTCTGATAACACAACCAGTGCAAGCAGGTATCCCTGTAATTGACGGTGGTAACTTGGCTCAAAATAT
TGTGACAGCGATGCAGGCTGCGGCACAAACGGCCAAACAGATTGAACAGTATCGCACTCAATTAAGTCAG
TACGAAAACATGCTGCAAAACTCGTTGGCCCCAGCTGCTTATATTTGGGACCAAGCACAATCGACCATCA
ATGGCTTAGTGCAAGCAACGAATACACTTCAATATTACCAAAATCAGCTTGGGAGCTTAGATCGTTATCT
TGGAAAATTCCAAGACGTTGCGTATTACCGTAGCTCGCCTTGTTTCTCAAATTCTGGTTGTAGTGAGGCT
GAATGGTCAGCAATGAATGAGAATCGCCGCCTGGCGTCAGAATCCCAAAAGAAGGCTAATGATGCTTTGT
TTAAAGGTTTAGAAAAGCAGCAGGACAATATAAAAGACGATGCTCGCCAGCTGCAACGACTCCAATCAAC
AGCGCAAGGGGCGCAAGGTCAACTAGAAGCTATTGGTTATGCCAATCAGCTCGCCAGTAACCAAACTAAC
CAACTGTTACAAATCCGTAGTTTGCTGATTGCTCAACAGAACGCAGTAGCAACCCGTATGCAAGTTGTGG
CCGATAGAGAAGCGCAACACCAAGCCTCAGCTGAACAGCTCCGAAAAGGAAGCTACACACCAAGCCCAGC
GCGTACCTGGTAA
 Primer design