SecReT4
Protein ID: 253723677
T4SS name [ID]Trb [57]
Gene symbolTrbK
Locus tagpP9014_p38
StrainPhotobacterium damselae subsp. piscicida plasmid pP9014 (NC_012919)
Repliconplasmid pP9014 [GenBank: NC_012919] [Browse all T4SS(s) in this replicon]
Location [Strand]36718..36942 [+]
ProductTrbK entry exclusion protein
Component typeTrbK
UniProt IDC5NNA4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 74 a.a.     [Download]
>gi|253723677|ref|YP_003023963.1| TrbK entry exclusion protein [Photobacterium damselae subsp. piscicida]
MKFNKLQALGAVILTALLAGCGDEPMPEVNDVNCTISNIKKIENQETKKEFATKCLRRSSTGDGELKSSP
KKEW
 
Nucleotide Sequence: 225 bp     [Download]
>gi|253723639|ref|NC_012919.1|:36718-36942 Photobacterium damselae subsp. piscicida plasmid pP9014 DNA, complete sequence
ATGAAATTTAACAAATTACAAGCACTAGGAGCCGTCATTCTGACGGCCCTATTAGCCGGATGTGGTGACG
AACCCATGCCAGAAGTAAATGATGTGAATTGCACTATCAGCAACATCAAGAAAATTGAAAACCAAGAGAC
AAAAAAGGAATTTGCAACTAAGTGTCTACGCCGTAGCAGCACTGGTGACGGTGAACTCAAATCTAGCCCT
AAAAAAGAATGGTAA
 Primer design