SecReT4
Protein ID: 253723678
T4SS name [ID]Trb [57]
Gene symbolTrbL
Locus tagpP9014_p39
StrainPhotobacterium damselae subsp. piscicida plasmid pP9014 (NC_012919)
Repliconplasmid pP9014 [GenBank: NC_012919] [Browse all T4SS(s) in this replicon]
Location [Strand]36952..38634 [+]
ProductTrbL plasmid conjugal transfer protein precursor
Component typeTrbL
UniProt IDC5NNA5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 8e-39, Aligned region: 65..279
Protein Sequence: 560 a.a.     [Download]
>gi|253723678|ref|YP_003023964.1| TrbL plasmid conjugal transfer protein precursor [Photobacterium damselae subsp. piscicida]
MKLPANLKIVMPVVVWLAFLIATPAHAAIDNSGLLDDVLARYSTAAASWASIIVDAASWLFWTLAVISMV
WTFGQILIRQGGLSEIFAELIRFTVVTGFFWWLLTNGPNFASDIYDSLRELAGNATGLGMGLSPSGIVDI
GFAIFDKVLDQSSFWSPGDSLAGILMGAVILVILALIGINMLLLLCAGWVLAYGGVFFLGFGGSRWTTDF
AINYYKTVLGLGAQLMAMVLLVGIGKTFLDDYYTAMSEGISLKEMGVMLIVAVILLVLTNKVPAMLAGII
TGASIGGAGVGAMGAGTAMGAAGMAMAAAATGGAAMSAGASNMAGGAQALMAAINKANENVSNGTDVMSS
LSGAIGGGGSADSSEAGTGSSPFAEAAGFADSSSPSSIETGSNSSESSSSSETPSSDSQKSGGFMAGASK
VGRVAADTGANLAKGIGSVAKAKSDNMKSKAMQRVGDTAGGKVAAAIKAQGQGSGSDSESPSFDNNSLSG
GSGGWVNQTGGFDALSSEDQDKARQSHADWQASNPDKNTFDVGEYVSYAQERQQERNEEVASFVNKDQTA
 
Nucleotide Sequence: 1683 bp     [Download]
>gi|253723639|ref|NC_012919.1|:36952-38634 Photobacterium damselae subsp. piscicida plasmid pP9014 DNA, complete sequence
ATGAAACTGCCAGCCAATCTTAAAATCGTTATGCCTGTGGTCGTCTGGTTGGCGTTTTTGATTGCCACCC
CAGCTCATGCAGCAATCGACAACTCAGGCTTACTTGATGATGTACTTGCTCGCTACTCTACAGCCGCGGC
CAGCTGGGCCAGCATTATCGTCGATGCGGCTAGTTGGTTATTTTGGACTCTAGCTGTTATTTCGATGGTG
TGGACGTTCGGACAAATTCTTATACGCCAAGGAGGATTAAGCGAGATTTTTGCTGAGTTGATCCGATTCA
CTGTGGTTACAGGTTTCTTTTGGTGGCTACTTACAAACGGACCTAATTTCGCATCAGATATTTACGACTC
TTTAAGAGAGTTAGCGGGTAATGCAACTGGCTTGGGTATGGGGTTATCACCATCAGGAATTGTTGATATT
GGCTTTGCCATTTTCGACAAAGTTCTAGATCAATCCTCTTTCTGGTCGCCAGGTGATTCGCTCGCAGGGA
TTTTAATGGGGGCCGTTATCCTCGTTATCCTGGCGTTAATTGGTATCAATATGCTGTTACTGCTTTGTGC
TGGTTGGGTGCTTGCCTATGGTGGTGTGTTCTTCTTAGGGTTTGGCGGTTCTCGCTGGACCACAGATTTT
GCAATCAACTATTACAAAACTGTCTTAGGTTTGGGTGCTCAATTAATGGCTATGGTGCTCCTGGTCGGTA
TTGGTAAAACATTCCTCGATGACTACTACACGGCTATGAGTGAAGGTATCAGCCTCAAAGAAATGGGCGT
GATGTTGATTGTTGCTGTAATTCTCTTAGTCCTCACAAACAAAGTCCCTGCAATGCTGGCAGGTATTATC
ACAGGCGCAAGTATTGGCGGTGCTGGAGTTGGGGCAATGGGCGCAGGCACCGCTATGGGGGCGGCAGGTA
TGGCAATGGCCGCAGCTGCAACGGGCGGCGCTGCTATGAGCGCAGGTGCTTCAAATATGGCAGGTGGTGC
TCAAGCACTTATGGCCGCAATCAACAAAGCAAACGAGAACGTATCAAACGGCACAGACGTTATGTCCAGT
CTAAGTGGCGCCATTGGCGGGGGTGGGAGTGCAGACAGCAGCGAAGCTGGCACTGGAAGTTCACCTTTTG
CCGAAGCCGCAGGTTTCGCTGATTCTTCGAGTCCTAGCAGTATTGAAACTGGCTCAAACAGTTCAGAAAG
CTCTAGCAGCAGTGAAACACCTTCAAGTGATAGCCAAAAATCGGGCGGTTTCATGGCTGGGGCAAGTAAA
GTTGGTCGTGTAGCTGCCGACACTGGCGCCAACTTAGCCAAAGGTATCGGTTCCGTTGCTAAAGCTAAAT
CAGACAATATGAAATCAAAAGCTATGCAGCGTGTCGGTGACACTGCGGGTGGTAAAGTCGCCGCAGCCAT
TAAAGCACAAGGCCAAGGTAGCGGCTCTGATAGCGAATCCCCTTCTTTCGACAATAACAGTCTAAGTGGC
GGTAGTGGCGGTTGGGTCAATCAAACAGGTGGCTTCGATGCACTTTCCAGCGAAGACCAAGACAAGGCCC
GTCAATCACACGCGGATTGGCAAGCAAGTAACCCAGATAAAAACACGTTTGATGTGGGTGAATATGTTTC
TTATGCGCAAGAACGTCAGCAAGAGCGCAACGAAGAAGTTGCTAGCTTTGTAAACAAAGATCAAACAGCT
TAA
 Primer design