SecReT4
Protein ID: 253723679
T4SS name [ID]Trb [57]
Gene symbolTrbN
Locus tagpP9014_p40
StrainPhotobacterium damselae subsp. piscicida plasmid pP9014 (NC_012919)
Repliconplasmid pP9014 [GenBank: NC_012919] [Browse all T4SS(s) in this replicon]
Location [Strand]39160..39774 [+]
ProductTrbN protein
Component typeTrbN
UniProt IDC5NNA6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 204 a.a.     [Download]
>gi|253723679|ref|YP_003023965.1| TrbN protein [Photobacterium damselae subsp. piscicida]
MLPFIADMPPLEQERVVCSISAAAKYEVPANIVLAVAEKESGKPGQWVKNSNGTHDVGFMQFNTAYLRDL
KKYGITAEHVAASGCYPFDLAAWRLRGHILKDSGDLWTRAANYHSRTPKYNQIYRADLMKKAIKWADWLD
ENFTTVDVTAQGGKTPSDSNKMRKVLEEAAKIEVKYNRSERQEKKGTVNALKAKGYVPRTISFN
 
Nucleotide Sequence: 615 bp     [Download]
>gi|253723639|ref|NC_012919.1|:39160-39774 Photobacterium damselae subsp. piscicida plasmid pP9014 DNA, complete sequence
ATGTTACCGTTTATTGCAGATATGCCACCTTTAGAACAAGAGCGCGTTGTGTGCTCAATTTCAGCAGCTG
CCAAATATGAAGTACCAGCCAACATTGTTTTGGCCGTGGCCGAAAAAGAATCAGGTAAACCAGGGCAATG
GGTTAAAAACTCAAACGGTACGCATGACGTTGGTTTTATGCAGTTTAATACAGCTTATTTACGCGATCTT
AAAAAGTATGGCATTACCGCAGAGCATGTAGCAGCGTCCGGCTGCTACCCTTTCGATCTCGCAGCATGGC
GACTTCGCGGGCATATCCTAAAAGATTCAGGGGACCTTTGGACTAGAGCGGCTAACTACCATTCACGGAC
GCCAAAATACAATCAAATTTATCGTGCTGACTTGATGAAAAAAGCGATCAAGTGGGCTGATTGGCTGGAT
GAAAACTTTACCACTGTTGATGTGACAGCTCAGGGGGGTAAAACCCCAAGTGATAGCAACAAGATGCGCA
AAGTATTGGAAGAAGCGGCAAAAATAGAAGTCAAATATAACCGTTCTGAACGCCAAGAAAAGAAGGGGAC
AGTTAACGCTTTAAAAGCTAAAGGTTATGTCCCTAGAACAATCTCGTTTAATTAG
 Primer design