SecReT4
Protein ID: 253751704
T4SS name [ID]Tra_Tn [664]
Gene symbol-
Locus tagSSUSC84_0831
StrainStreptococcus suis SC84
Repliconchromosome [GenBank: NC_012924] [Browse all T4SS(s) in this replicon]
Location [Strand]898387..900834 [-]
Producthypothetical protein
Component typeOrf16_Tn
UniProt IDA8CUJ0, C6GN61
KEGG IDsss:SSUSC84_0831
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.3e-33, Aligned region: 468..763
Protein Sequence: 815 a.a.     [Download]
>gi|253751704|ref|YP_003024845.1| hypothetical protein SSUSC84_0831 [Streptococcus suis SC84]
MAYPIKYIENNLVWNKDGECYAYYELVPYNYSFLSPEQKIQVHDSFRQLIAQNRDGKIHALQISTESSIR
SAQERSKNEVTGKLKAVAYDKIDQQTDALISMIGENQVNYRFFIGFKLLLNDQEFSMKSLTVEAKNALSD
FVYDVNHKLMGDFVSMSNDEILRFQKMEKLLENKISRRFKIRRLDKDDFGYLIEHLYGQTGTAYEEYEYH
LSKKKLDNETLIKYYDLIKPTRCLVEEKQRYLKIQQEDETVYVAYFTINSIVGELDFPSSEIFYYQQQQF
TFPIDTSMNVEIVANRKALSTVRNKKKELKDLDNHAWQSDNETSSNVAEALESVNELETNLDQSKESMYK
LSYVVRVSANDLDELKRRCNEVKDFYDDLSVKLVRPFGDMLGLHEEFLPASKRYMNDYIQYVTSDFLAGL
GFGATQMLGENEGIYVGYSLDTGRNVYLKPALASQGVKGSVTNALASAFVGSLGGGKSFANNLIVYYAVL
YGAQAVIVDPKAERGRWKETLPEISHEINIVTLTSDEKNKGLLDPYVIMKNPKDSESLAIDILTFLTGIS
SRDGERFPILRKAIRAVTNSEVRGLMKVIEELRVENTPLSTSIADHIESFTDYDFAHLLFSNGYVEQSIS
LEKQLNIIQVADLVLPDKETSFEEYTTMELLSVAMLIVISTFALDFIHTDRSIFKIVDLDEAWSFLQVAQ
GKTLSMKLVRAGRAMNAGVYFVTQNTDDLLDEKLKNNLGLKFAFRSTDLNEIKKTLAFFGVDPEDENNQK
RLRDLENGQCLISDLYGRVGVIQFHPVFEELLHAFDTRPPVRKEV
 
Nucleotide Sequence: 2448 bp     [Download]
>gi|253750923|ref|NC_012924.1|:c900834-898387 Streptococcus suis SC84, complete genome
ATGGCATATCCAATTAAATACATTGAAAACAATCTCGTCTGGAATAAAGACGGGGAATGTTATGCTTACT
ATGAGCTTGTTCCTTACAATTACTCATTTCTAAGTCCAGAACAGAAAATACAAGTGCATGATTCTTTCAG
ACAGCTTATCGCACAAAATCGTGATGGCAAAATTCATGCTTTACAAATCAGTACAGAATCCAGCATACGT
TCTGCACAAGAGCGTTCCAAAAATGAAGTCACTGGCAAGCTCAAAGCGGTTGCCTATGACAAAATCGACC
AACAGACAGACGCTTTAATATCCATGATTGGCGAAAATCAAGTGAACTACCGTTTCTTTATCGGCTTTAA
GTTGCTTCTCAACGATCAGGAGTTTTCTATGAAAAGTCTTACCGTTGAAGCAAAAAATGCTTTGTCTGAT
TTTGTCTATGATGTGAACCATAAGCTGATGGGCGATTTTGTTAGTATGAGTAATGATGAAATCCTGCGTT
TTCAGAAGATGGAAAAGCTCTTAGAAAATAAAATCTCTCGTCGTTTCAAAATCCGCAGGTTAGATAAGGA
CGACTTCGGCTATCTGATTGAACACCTTTACGGACAGACAGGCACTGCCTATGAAGAGTATGAGTACCAT
CTATCAAAGAAAAAGCTGGATAATGAAACGCTGATTAAATACTATGACTTGATTAAGCCTACTCGCTGTT
TGGTGGAAGAAAAACAGCGATATTTGAAAATCCAGCAGGAAGATGAAACCGTCTATGTAGCTTACTTTAC
CATTAACAGCATTGTCGGAGAACTGGACTTCCCGTCCTCTGAAATCTTCTACTACCAGCAACAGCAATTT
ACATTCCCGATTGATACGTCAATGAATGTGGAAATTGTAGCGAATCGTAAAGCCCTATCTACTGTCCGCA
ATAAAAAGAAAGAACTGAAAGACTTGGATAACCACGCTTGGCAAAGTGATAATGAAACCAGCTCCAATGT
GGCGGAAGCTCTGGAAAGTGTGAATGAGCTGGAAACCAATTTAGACCAAAGCAAGGAATCTATGTACAAG
CTGTCTTATGTGGTAAGGGTATCAGCAAATGATCTTGACGAACTCAAACGTCGTTGTAATGAAGTGAAAG
ATTTTTATGACGATTTAAGCGTAAAACTGGTACGACCATTTGGGGATATGCTCGGCTTACATGAAGAATT
TTTACCTGCCAGCAAGCGTTATATGAATGATTATATTCAATACGTGACCTCTGATTTCCTCGCTGGTTTA
GGTTTTGGTGCTACTCAAATGCTGGGGGAAAATGAGGGGATTTATGTTGGCTACAGCTTAGATACTGGAC
GCAATGTCTATCTGAAACCTGCTCTTGCCAGTCAAGGGGTTAAGGGTTCAGTAACCAATGCGTTAGCGTC
GGCTTTTGTTGGTTCGCTGGGTGGTGGTAAATCCTTTGCGAATAACCTTATCGTCTATTATGCGGTGCTT
TATGGGGCACAAGCAGTGATTGTAGACCCAAAAGCAGAACGTGGCAGATGGAAAGAAACCTTGCCAGAGA
TTTCCCATGAAATCAATATCGTCACTCTGACTTCTGATGAGAAAAACAAAGGCTTACTTGACCCTTATGT
GATTATGAAAAATCCCAAAGATTCTGAATCACTGGCTATTGATATTCTGACATTCCTTACGGGGATTTCC
TCTCGTGATGGGGAACGCTTCCCAATCCTTAGAAAAGCCATTCGTGCAGTAACCAATAGTGAAGTACGAG
GGTTGATGAAAGTGATTGAGGAATTACGGGTTGAGAATACGCCACTAAGTACCAGTATAGCCGACCATAT
CGAAAGTTTTACAGACTATGACTTTGCACATTTATTATTCAGTAATGGTTATGTGGAGCAGTCTATCAGC
TTAGAAAAACAACTGAACATTATACAGGTTGCGGACTTGGTACTTCCCGACAAGGAAACTTCCTTTGAGG
AATATACCACTATGGAGCTTTTATCCGTTGCTATGCTGATTGTCATTAGTACCTTTGCTTTAGACTTTAT
CCATACAGACCGAAGCATTTTCAAGATTGTAGATTTAGACGAAGCATGGAGCTTTTTACAGGTAGCACAA
GGAAAAACACTATCTATGAAGCTGGTTCGGGCTGGTCGTGCTATGAACGCTGGGGTATATTTCGTGACCC
AAAATACAGACGACCTCTTAGATGAAAAACTGAAAAATAACCTCGGCTTAAAATTTGCATTTCGTTCCAC
TGACCTTAACGAGATTAAAAAGACCTTAGCCTTTTTTGGTGTAGACCCAGAGGACGAAAACAATCAGAAG
CGATTGCGTGATTTGGAAAACGGGCAATGCCTTATCAGTGATTTATATGGTCGTGTCGGTGTGATACAGT
TCCACCCTGTATTTGAAGAACTGCTCCATGCCTTTGATACCAGACCACCTGTGCGAAAAGAGGTGTAA
 Primer design