SecReT4
Protein ID: 253755107
T4SS name [ID]Tra_Tn [665]
Gene symbol-
Locus tagSSUBM407_0484
StrainStreptococcus suis BM407
Repliconchromosome [GenBank: NC_012926] [Browse all T4SS(s) in this replicon]
Location [Strand]541683..542615 [-]
Producthypothetical protein
Component typeOrf13_Tn
UniProt IDC6GWE2
KEGG IDssb:SSUBM407_0484
PDB IDNA
Domain hit(s) vs Pfam TpcC [PF12642], Evalue: 1e-62, Aligned region: 83..309
Protein Sequence: 310 a.a.     [Download]
>gi|253755107|ref|YP_003028247.1| hypothetical protein SSUBM407_0484 [Streptococcus suis BM407]
MRKEDLMMKFRKNQNKEKQIPKEKKPRVYKVNPHKKVVIALWVLLGLSFSFAIFKHFTAIDTHTIHETTI
IEKEYVDTHHVENFVENFAKVYYSWEQSDKSIDNRMESLKGYLTDELQALNVDTVRKDIPVSSSVRGFQI
WTVEPTGDNEFNVTYSVDQLITEGENTKTVHSAYIVSVYVDGSGNMVLVKNPTITNIPKKSSYKPKAIES
EGTVDSITTNEINEFLTTFFKLYPTATASELSYYVNDGILKPIGKEYIFQELVNPIHNRKDNQVTVSLTV
EYIDQQTKATQVSQFDLVLEKNGSNWKIIE
 
Nucleotide Sequence: 933 bp     [Download]
>gi|253754647|ref|NC_012926.1|:c542615-541683 Streptococcus suis BM407 chromosome, complete genome
ATGAGAAAGGAAGATTTAATGATGAAATTTAGAAAAAATCAGAATAAAGAAAAACAGATACCAAAGGAAA
AGAAACCTCGTGTCTATAAGGTCAATCCTCATAAAAAGGTTGTGATTGCCTTGTGGGTACTTTTAGGGCT
TAGTTTCAGCTTTGCGATATTCAAGCACTTTACAGCTATAGATACTCATACTATTCACGAAACAACTATC
ATAGAAAAGGAATACGTTGATACTCATCATGTAGAAAATTTTGTAGAGAACTTTGCGAAAGTCTACTATT
CATGGGAGCAATCCGATAAGTCCATTGATAATCGAATGGAAAGTCTAAAAGGCTATCTGACAGATGAACT
TCAAGCTCTCAATGTTGATACAGTACGCAAAGATATTCCTGTATCGTCTTCTGTAAGAGGATTTCAGATA
TGGACGGTAGAGCCAACTGGCGACAATGAGTTTAATGTAACCTACAGTGTAGACCAGCTCATTACAGAGG
GAGAAAATACAAAGACCGTCCACTCTGCTTATATAGTGAGTGTCTATGTAGATGGTTCTGGAAATATGGT
ACTGGTTAAGAATCCGACCATTACCAACATACCTAAGAAATCAAGTTATAAACCAAAAGCCATTGAAAGT
GAGGGGACGGTTGATTCCATTACAACCAATGAAATCAATGAGTTTTTAACGACGTTCTTCAAGCTCTATC
CTACAGCGACAGCCAGTGAACTTTCCTACTATGTGAATGACGGGATATTAAAACCAATCGGAAAAGAGTA
CATCTTTCAAGAACTGGTAAATCCTATTCACAATCGTAAGGATAATCAAGTCACGGTATCGCTGACAGTG
GAGTATATCGACCAGCAGACCAAAGCAACGCAGGTATCTCAATTTGATTTGGTACTTGAAAAGAACGGGA
GTAATTGGAAGATTATAGAATAA
 Primer design