SecReT4
Protein ID: 253755109
T4SS name [ID]Tra_Tn [665]
Gene symbol-
Locus tagSSUBM407_0486
StrainStreptococcus suis BM407
Repliconchromosome [GenBank: NC_012926] [Browse all T4SS(s) in this replicon]
Location [Strand]543610..545787 [-]
Producthypothetical protein
Component typeOrf15_Tn
UniProt IDC6GWE4
KEGG IDssb:SSUBM407_0486
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 725 a.a.     [Download]
>gi|253755109|ref|YP_003028249.1| hypothetical protein SSUBM407_0486 [Streptococcus suis BM407]
MKPSIVNRIKSNWTLKRLGKVAMTVAFTLVIAIFLLAMLGTVVQAAGLVDDTVNVANEYSRYPLENYQLD
FYVDNSWGWLPWNWSDGIGKQVMYGLYAITNFIWTISLYVSNATGYLVQEAYSLDFISATADSIGKNMQT
LAGVSANGFSTEGFYVGFLLLLILVLGVYVAYTGLIKRETTKAIHAIMNFVLVFILSASFIAYAPDYIKK
INDFSSDISNASLSLGTKIVMPHSDSQGKDSVDLIRDSLFSIQVQQPWLLLQYNSSDIESIGIDRVESLL
STSPDSNNGEDREKIVAEEIEDRSNTNLTITKTINRLGTVFFLFVFNIGISIFVFLLTGIMIFSQVLFII
YAMFLPVSFILSMIPSFDGMSKRAITKLFNTILTRAGITLIITTAFSISTMLYTLSAGYPFFLIAFLQIV
TFAGIYFKLGDLMSMFSLQSNDSQSVGSRVMRKPRMLMHAHMHRLQRKLGRSMTTLGAGSAIVTGKKGQS
GSGSSARTQADHSRPDGKEKSTLGKRIGQTIGTVADTKDRMVDTASGLKEQVKDLPTNARYAVYQGKSKV
KENVRDLTSSISQTKADRASGRKEQQEQRRKTIAKRRSEMEQVKQKKQPASSVHERPTTRQEQYHDEQTS
KQSNIQTSYKESQQAKQERPAVKSDFSSPKVERQGNTVQEKTVQKPATSTTTADRTSQRPITKERPSTVQ
RVPLQNTRSRPPIKTATIKKVGKKP
 
Nucleotide Sequence: 2178 bp     [Download]
>gi|253754647|ref|NC_012926.1|:c545787-543610 Streptococcus suis BM407 chromosome, complete genome
GTGAAACCATCAATAGTAAACAGAATAAAATCAAACTGGACGCTGAAACGTCTAGGTAAAGTGGCAATGA
CAGTGGCTTTCACACTTGTGATTGCCATTTTTCTTTTAGCCATGCTGGGAACGGTGGTTCAAGCTGCGGG
CTTGGTAGATGATACGGTCAATGTGGCAAATGAATACAGCCGATACCCACTTGAAAACTATCAACTGGAT
TTTTATGTGGATAATAGCTGGGGCTGGCTTCCGTGGAACTGGTCGGACGGGATTGGAAAACAGGTCATGT
ATGGACTATATGCCATTACCAATTTTATTTGGACAATCAGTTTGTATGTTTCCAATGCGACAGGTTACTT
AGTACAGGAAGCCTATTCCTTAGACTTCATTTCCGCTACAGCAGATTCCATTGGTAAGAATATGCAGACC
TTAGCTGGTGTGAGTGCAAACGGATTTTCAACAGAGGGTTTCTATGTTGGATTCCTCTTACTCTTGATTT
TGGTTCTTGGGGTTTATGTTGCCTATACGGGACTGATAAAGAGAGAAACCACAAAGGCAATTCATGCCAT
TATGAATTTTGTGCTGGTGTTTATCCTATCGGCTTCCTTTATTGCCTACGCTCCCGACTACATTAAAAAA
ATCAATGACTTTTCATCAGACATCAGTAATGCCAGTTTATCACTTGGCACGAAGATTGTCATGCCCCATT
CCGATAGTCAAGGCAAGGACAGCGTGGACTTAATCAGAGATAGCCTGTTTTCCATACAGGTTCAGCAACC
GTGGCTACTGCTTCAATACAACAGTTCAGACATTGAAAGTATCGGTATTGACCGTGTGGAAAGCCTGCTC
TCCACCAGCCCAGATTCCAACAATGGCGAAGACAGAGAAAAAATTGTTGCGGAAGAAATTGAAGACAGAA
GCAATACCAATCTAACCATTACAAAGACCATTAACCGTTTAGGTACAGTCTTCTTCCTATTTGTCTTCAA
TATTGGGATTTCCATATTTGTATTCCTATTAACAGGAATCATGATTTTCTCGCAGGTACTTTTTATCATC
TATGCTATGTTTCTGCCTGTGAGCTTTATTTTAAGCATGATTCCATCATTTGATGGTATGTCAAAACGAG
CCATAACAAAGCTCTTTAATACCATTTTGACACGAGCTGGAATCACATTGATTATTACGACAGCATTTAG
TATTTCAACCATGCTCTATACCTTATCGGCTGGTTATCCGTTCTTTTTGATTGCTTTTCTACAGATTGTG
ACCTTTGCAGGAATCTACTTCAAGCTGGGCGATTTAATGAGTATGTTTTCTCTACAGAGTAACGATTCTC
AAAGTGTGGGAAGTCGTGTGATGAGAAAACCTCGTATGCTTATGCACGCTCACATGCACCGTCTACAGCG
GAAACTTGGACGTTCCATGACTACTCTAGGGGCTGGGTCTGCCATTGTTACAGGTAAAAAAGGACAGTCG
GGTTCGGGGAGTTCTGCAAGGACACAAGCAGATCACTCCCGACCAGACGGAAAGGAAAAATCAACACTTG
GAAAACGTATCGGTCAAACCATCGGTACAGTAGCTGATACCAAAGACAGAATGGTAGACACTGCTAGTGG
TTTGAAAGAACAGGTTAAAGATTTGCCGACCAATGCAAGATATGCAGTATATCAAGGAAAATCCAAAGTA
AAAGAGAATGTCCGTGATTTAACCAGTAGTATTTCTCAAACCAAAGCGGACAGAGCCAGTGGACGCAAGG
AACAGCAGGAACAAAGGCGAAAAACCATTGCGAAGCGTCGCTCTGAAATGGAACAGGTCAAACAGAAAAA
ACAGCCTGCTTCTTCTGTTCATGAAAGACCGACTACAAGACAAGAACAATATCATGATGAACAGACCTCA
AAACAGTCTAATATTCAGACTTCATATAAGGAATCTCAACAAGCCAAACAAGAGCGTCCAGCAGTTAAGT
CCGATTTTTCAAGTCCAAAAGTGGAACGCCAAGGCAATACCGTTCAAGAAAAAACCGTTCAAAAGCCAGC
AACTTCAACCACTACAGCAGATAGAACTTCACAACGTCCAATCACAAAAGAACGTCCGTCTACTGTTCAA
AGAGTACCACTACAAAATACAAGAAGTAGACCACCAATCAAAACCGCCACCATTAAGAAAGTCGGTAAGA
AACCATGA
 Primer design