SecReT4
Protein ID: 253755113
T4SS name [ID]Tra_Tn [665]
Gene symbol-
Locus tagSSUBM407_0490
StrainStreptococcus suis BM407
Repliconchromosome [GenBank: NC_012926] [Browse all T4SS(s) in this replicon]
Location [Strand]549316..549537 [-]
Producthypothetical protein
Component typeOrf19_Tn
UniProt IDC6GT46
KEGG IDssb:SSUBM407_0490, ssb:SSUBM407_0974
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 73 a.a.     [Download]
>gi|253755113|ref|YP_003028253.1| hypothetical protein SSUBM407_0490 [Streptococcus suis BM407]
MNFGQNLYNWFLSNAQSLVLLAIVVIGLYLGFKREFSKLIGFLIIAIIAVGLVFNAAGVKDILLELFNRI
IGA
 
Nucleotide Sequence: 222 bp     [Download]
>gi|253754647|ref|NC_012926.1|:c549537-549316 Streptococcus suis BM407 chromosome, complete genome
ATGAATTTTGGACAAAACCTTTATAACTGGTTTCTATCAAACGCTCAATCACTGGTGCTTTTAGCAATCG
TTGTGATTGGCTTGTATCTTGGCTTCAAGCGTGAGTTTAGCAAACTGATTGGCTTTTTAATTATTGCGAT
TATTGCGGTTGGCTTAGTCTTCAACGCTGCTGGAGTAAAAGACATTTTACTAGAGCTATTCAATCGCATT
ATTGGTGCTTAA
 Primer design