SecReT4
Protein ID: 253755115
T4SS name [ID]Tra_Tn [665]
Gene symbol-
Locus tagSSUBM407_0492
StrainStreptococcus suis BM407
Repliconchromosome [GenBank: NC_012926] [Browse all T4SS(s) in this replicon]
Location [Strand]550963..552348 [-]
ProductFtsK/SpoIIIE family protein
Component typeOrf21_Tn
UniProt IDC6GWF0
KEGG IDssb:SSUBM407_0492
PDB IDNA
Domain hit(s) vs Pfam FtsK_SpoIIIE [PF01580], Evalue: 1.5e-41, Aligned region: 187..365
AAA_10 [PF12846], Evalue: 4.4e-06, Aligned region: 222..259
DUF87 [PF01935], Evalue: 2.3e-05, Aligned region: 222..340
Protein Sequence: 461 a.a.     [Download]
>gi|253755115|ref|YP_003028255.1| FtsK/SpoIIIE family protein [Streptococcus suis BM407]
MKQRGKRIRPSGKDLVFHFTIASLLPVFLLVVGLFHVKTIQQINWQDFNLSQADKIDIPYLIISFSVAIL
ICLLVAFVFKRVRYDTVKQLYHRQKLAKMILENKWYESEQVKTEGFFKDSAGRTKEKITYFPKMYYRLKN
GLIQIRVEITLGKYQDQLLHLEKKLESGLYCELTDKELKDSYVEYTLLYDTIASRISIDEVEAKDGKLRL
MKNVWWEYDKLPHMLIAGGTGGGKTYFILTLIEALLHTDSKLYILDPKNADLADLGSVMANVYYRKEDLL
SCIETFYEEMMKRSEEMKQMKNYKTGKNYAYLGLPAHFLIFDEYVAFMEMLGTKENTAVMNKLKQIVMLG
RQAGFFLILACQRPDAKYLGDGIRDQFNFRVALGRMSEMGYGMMFGSDVQKDFFLKRIKGRGYVDVGTSV
ISEFYTPLVPKGYDFLEEIKKLSNSRQSTQATCEAEVAGVD
 
Nucleotide Sequence: 1386 bp     [Download]
>gi|253754647|ref|NC_012926.1|:c552348-550963 Streptococcus suis BM407 chromosome, complete genome
ATGAAACAGCGTGGTAAAAGGATTCGCCCATCTGGTAAAGATTTAGTCTTTCATTTTACGATAGCGTCAC
TCCTGCCTGTTTTCCTGCTGGTTGTCGGACTGTTTCATGTGAAGACAATCCAGCAGATCAACTGGCAGGA
TTTTAACCTATCACAAGCAGATAAGATTGACATTCCCTATTTAATTATCAGTTTCAGTGTCGCAATTCTT
ATCTGCTTGCTGGTAGCGTTTGTATTCAAACGGGTTCGCTATGATACGGTTAAACAACTTTACCACCGTC
AAAAACTGGCAAAGATGATACTTGAAAACAAGTGGTATGAATCTGAACAGGTCAAAACAGAGGGTTTCTT
TAAAGATAGTGCTGGTCGTACAAAGGAAAAGATAACCTACTTCCCTAAAATGTATTATCGACTTAAAAAT
GGCTTGATACAGATACGGGTGGAAATCACGCTGGGAAAATATCAAGACCAACTCTTACACTTGGAAAAGA
AATTAGAGAGTGGCTTGTACTGTGAGCTGACGGATAAAGAGTTAAAGGATTCCTATGTGGAATATACTTT
GCTCTATGACACCATAGCCAGTCGTATTTCTATTGATGAAGTAGAAGCTAAAGATGGTAAACTTCGCTTA
ATGAAAAACGTATGGTGGGAATATGATAAGCTCCCTCATATGTTGATTGCTGGTGGTACAGGTGGCGGTA
AAACTTACTTTATACTGACACTGATTGAAGCCTTGCTTCATACAGATTCAAAACTGTATATTCTTGACCC
GAAAAATGCTGATCTTGCGGACTTAGGTTCTGTGATGGCAAATGTCTACTATAGAAAAGAAGACTTGCTT
TCTTGCATTGAAACATTCTATGAAGAAATGATGAAACGTAGTGAGGAAATGAAGCAGATGAAGAACTATA
AGACTGGCAAAAATTATGCTTACTTAGGTCTCCCGGCACACTTCTTAATCTTTGATGAATACGTCGCTTT
CATGGAAATGCTGGGAACAAAAGAAAACACCGCAGTTATGAATAAGCTGAAACAGATTGTCATGTTAGGT
CGTCAAGCTGGCTTCTTTCTAATACTGGCTTGTCAACGTCCAGACGCAAAATATTTAGGCGACGGAATCC
GTGATCAGTTTAATTTCAGAGTGGCTTTAGGTCGTATGTCTGAAATGGGCTATGGCATGATGTTTGGCAG
TGACGTACAAAAGGATTTCTTCTTAAAGCGAATCAAAGGTCGTGGCTATGTTGATGTAGGAACAAGTGTC
ATATCAGAGTTTTATACTCCCCTTGTACCAAAAGGATATGATTTCTTGGAGGAAATTAAAAAGTTATCCA
ACAGCAGACAGTCCACGCAGGCGACGTGCGAAGCGGAAGTCGCAGGTGTGGACTGA
 Primer design