SecReT4
Protein ID: 253801026
T4SS name [ID]Tra_F [109]
Gene symbolygfA
Locus tagpVir_53
StrainEscherichia coli Vir68 plasmid pVir68 (NC_012944)
Repliconplasmid pVir68 [GenBank: NC_012944] [Browse all T4SS(s) in this replicon]
Location [Strand]56097..56699 [-]
Productlytic transglycosylase
Component typeOrf169_F
UniProt IDC5ZZJ6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 200 a.a.     [Download]
>gi|253801026|ref|YP_003034027.1| lytic transglycosylase [Escherichia coli Vir68]
MVLLVVRTTNLLSLFVEWVKLFTDKVTRGGKMKKWMLAICLMFINENCLATDCFDLAGRDYKIDPDLLRA
ISWKESRYRVNAIGINPVTGYGSGLMQVDSQHFNELARYGIKPEHLTTDPCMNIYTGAYYLAIAFKKWGV
SWEAVGAYNAGFRKTERQNQRRLAYASDVYRIYTGIKSSKGIRLPATKKSLPEINSVQNN
 
Nucleotide Sequence: 603 bp     [Download]
>gi|253800975|ref|NC_012944.1|:c56699-56097 Escherichia coli Vir68 plasmid pVir68, complete sequence
GTGGTGCTTTTGGTGGTGAGAACCACCAACCTGTTGAGCCTTTTTGTGGAGTGGGTTAAATTATTTACGG
ATAAAGTCACCAGAGGTGGAAAAATGAAAAAATGGATGTTAGCCATCTGCCTGATGTTTATAAATGAGAA
CTGCCTAGCCACTGATTGCTTTGATCTTGCAGGCAGGGATTACAAAATAGATCCTGATTTACTGAGAGCA
ATATCATGGAAAGAATCCCGTTACCGGGTTAATGCCATCGGTATTAATCCGGTAACGGGATATGGCAGCG
GACTGATGCAGGTAGATTCCCAGCATTTTAACGAACTGGCCCGCTACGGAATTAAGCCGGAACATCTGAC
AACAGATCCCTGCATGAACATTTATACCGGTGCTTATTATCTGGCAATAGCCTTTAAAAAATGGGGCGTC
TCCTGGGAGGCCGTTGGTGCATACAATGCCGGATTCAGGAAGACCGAACGCCAGAACCAGAGACGTCTTG
CCTACGCATCAGATGTTTACCGGATTTATACCGGGATAAAAAGCAGTAAAGGTATCCGGCTTCCGGCCAC
GAAGAAATCACTTCCGGAAATTAACAGCGTGCAGAACAATTAA
 Primer design