SecReT4
Protein ID: 253801027
T4SS name [ID]Tra_F [109]
Gene symboltraM
Locus tagpVir_54
StrainEscherichia coli Vir68 plasmid pVir68 (NC_012944)
Repliconplasmid pVir68 [GenBank: NC_012944] [Browse all T4SS(s) in this replicon]
Location [Strand]57032..57403 [+]
Productconjugal transfer protein TraM
Component typeTraM_F
UniProt IDC5ZZJ7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Tra_M [PF05261], Evalue: 5.2e-54, Aligned region: 1..121
Protein Sequence: 123 a.a.     [Download]
>gi|253801027|ref|YP_003034028.1| conjugal transfer protein TraM [Escherichia coli Vir68]
MARVNLYISNEVHEKINMIVEKRRQEGARDKDISLSGTASMLLELGLRVYDAQMERKESAFNQTEFNKLL
LECVVKTQSTVAKILGIESLSPHVSGNPKFEYASMVDDIREKVSVEMDRFSQK
 
Nucleotide Sequence: 372 bp     [Download]
>gi|253800975|ref|NC_012944.1|:57032-57403 Escherichia coli Vir68 plasmid pVir68, complete sequence
ATGGCCAGAGTAAATCTGTATATTAGTAATGAGGTTCATGAAAAAATTAACATGATTGTTGAAAAGCGTC
GTCAGGAGGGAGCAAGAGATAAAGATATAAGCCTTTCAGGAACTGCTTCAATGCTTCTTGAATTAGGGCT
CCGTGTATATGACGCTCAGATGGAGCGTAAAGAGTCTGCATTTAACCAGACAGAGTTTAATAAACTTCTT
CTTGAATGTGTTGTAAAAACACAGTCAACGGTGGCAAAGATTTTAGGTATTGAATCTCTCAGTCCTCATG
TATCCGGAAACCCGAAGTTTGAATATGCCAGTATGGTTGACGATATCAGAGAGAAAGTGTCTGTTGAGAT
GGACCGGTTTTCCCAAAAATGA
 Primer design