SecReT4
Protein ID: 253801029
T4SS name [ID]Tra_F [109]
Gene symboltraA
Locus tagpVir_56
StrainEscherichia coli Vir68 plasmid pVir68 (NC_012944)
Repliconplasmid pVir68 [GenBank: NC_012944] [Browse all T4SS(s) in this replicon]
Location [Strand]58645..59010 [+]
Productconjugal transfer pilin subunit TraA
Component typeTraA_F
UniProt IDC5ZZJ9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraA [PF05513], Evalue: 4.4e-58, Aligned region: 1..120
Protein Sequence: 121 a.a.     [Download]
>gi|253801029|ref|YP_003034030.1| conjugal transfer pilin subunit TraA [Escherichia coli Vir68]
MDVVLSVQGASAPVKKKSFFSKFTRLNMLRLARAVLPAAVLMMFFPQLAMAAGSSGQDLMASGNTTVKAT
FGKDSSVVKWVVLAEVLVGAVMYMMTKNVKFLAGFAIISVFIAVGMAVVGL
 
Nucleotide Sequence: 366 bp     [Download]
>gi|253800975|ref|NC_012944.1|:58645-59010 Escherichia coli Vir68 plasmid pVir68, complete sequence
ATGGACGTCGTTTTAAGTGTTCAGGGTGCTTCTGCGCCCGTCAAAAAGAAATCGTTTTTTTCCAAATTCA
CTCGTCTGAATATGCTTCGCCTGGCTCGCGCAGTGCTCCCGGCTGCTGTTCTGATGATGTTCTTCCCGCA
GCTGGCGATGGCCGCCGGCAGCAGTGGTCAGGACCTGATGGCAAGCGGTAACACCACGGTTAAGGCGACC
TTCGGTAAGGACTCCAGTGTTGTTAAATGGGTTGTTCTGGCTGAAGTTCTGGTCGGTGCTGTCATGTACA
TGATGACCAAAAACGTCAAGTTCCTGGCCGGTTTTGCCATCATCTCTGTATTTATTGCTGTGGGTATGGC
CGTCGTTGGCCTCTGA
 Primer design