SecReT4
Protein ID: 253801032
T4SS name [ID]Tra_F [109]
Gene symboltraB
Locus tagpVir_59
StrainEscherichia coli Vir68 plasmid pVir68 (NC_012944)
Repliconplasmid pVir68 [GenBank: NC_012944] [Browse all T4SS(s) in this replicon]
Location [Strand]59911..60639 [+]
Productconjugal transfer protein TraK
Component typeTraK_F
UniProt IDC5ZZK2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 4.3e-70, Aligned region: 12..235
Protein Sequence: 242 a.a.     [Download]
>gi|253801032|ref|YP_003034033.1| conjugal transfer protein TraK [Escherichia coli Vir68]
MRKNNTAIIFGSLFFSCSVMAANGTLAPTVVPMVNGGQASIAISNTSPNLFTVPGDRIIAVNSLDGALTN
NEQTASGGVVVATVNKKPFTFILETERGLNLSIQAVPREGAGRTIQLVSDLRGTGEEAGAWETSTPYESL
LVTISQAVRGGKLPAGWYQVPVTKETLQAPAGLSSVADAVWTGNHLKMVRFAVENKTLSALNIRESDFWQ
PGTRAVMFSQPASQLLAGARMDVYVIRDGEGN
 
Nucleotide Sequence: 729 bp     [Download]
>gi|253800975|ref|NC_012944.1|:59911-60639 Escherichia coli Vir68 plasmid pVir68, complete sequence
ATGAGAAAAAATAATACGGCAATAATATTCGGCAGCCTGTTTTTTTCCTGCAGCGTGATGGCCGCAAACG
GTACGCTGGCCCCCACCGTGGTGCCAATGGTGAACGGTGGTCAGGCCAGTATTGCCATCAGCAATACCAG
CCCGAATCTGTTTACCGTTCCCGGTGACCGGATTATCGCCGTGAACAGTCTGGATGGTGCCCTGACCAAT
AATGAGCAGACCGCCTCCGGCGGTGTGGTGGTTGCCACCGTCAACAAAAAGCCCTTTACGTTCATTCTGG
AAACAGAACGTGGTCTGAATCTTTCCATTCAGGCTGTTCCCCGTGAAGGCGCGGGGCGTACCATTCAGCT
GGTCAGTGACCTGCGCGGAACCGGAGAAGAAGCCGGTGCGTGGGAAACGTCCACGCCTTACGAATCCCTG
CTTGTGACCATCAGCCAGGCCGTCCGTGGCGGAAAATTACCCGCAGGCTGGTATCAGGTCCCAGTGACAA
AGGAAACCCTGCAGGCCCCGGCGGGGCTGTCTTCAGTGGCAGATGCCGTATGGACGGGGAATCACCTGAA
GATGGTCCGCTTTGCCGTGGAAAATAAAACGCTGTCTGCCCTGAATATCCGGGAAAGTGACTTCTGGCAG
CCGGGAACCCGTGCCGTGATGTTCAGCCAGCCTGCCAGCCAGTTACTGGCAGGTGCGCGCATGGATGTGT
ATGTCATCCGTGACGGGGAGGGCAACTGA
 Primer design