SecReT4
Protein ID: 253801036
T4SS name [ID]Tra_F [109]
Gene symboltraV
Locus tagpVir_63
StrainEscherichia coli Vir68 plasmid pVir68 (NC_012944)
Repliconplasmid pVir68 [GenBank: NC_012944] [Browse all T4SS(s) in this replicon]
Location [Strand]63090..63605 [+]
Productconjugal transfer protein TraV
Component typeTraV_F
UniProt IDC5ZZK6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 4.5e-40, Aligned region: 23..165
Protein Sequence: 171 a.a.     [Download]
>gi|253801036|ref|YP_003034037.1| conjugal transfer protein TraV [Escherichia coli Vir68]
MKQISFFIPLLGTLLLSGCAGTSTEFECNATTSDTCMTMEQANEKAKKLEQSSEAKPVAASLPRLAEGNF
RTMPVQTVTATTPSGSRPAVTAHPEQKLLAPRPLFTAAREVKTVVPVSSVTPVTPPRPLRTGEQTAALWI
APYIDNQDVYHQPSSVFFVIKPSAWGKPRIN
 
Nucleotide Sequence: 516 bp     [Download]
>gi|253800975|ref|NC_012944.1|:63090-63605 Escherichia coli Vir68 plasmid pVir68, complete sequence
ATGAAACAGATTTCTTTCTTTATTCCTCTGCTGGGGACCTTATTACTTTCCGGCTGTGCCGGAACCAGTA
CGGAATTTGAGTGTAACGCCACCACATCCGATACCTGTATGACGATGGAGCAGGCCAATGAGAAGGCCAA
AAAACTGGAGCAGTCCTCAGAAGCAAAGCCGGTTGCGGCATCACTGCCGCGCCTGGCTGAAGGGAACTTC
CGGACAATGCCGGTGCAGACCGTCACCGCGACCACTCCGTCCGGCAGCAGACCTGCGGTGACAGCACATC
CGGAGCAGAAACTGCTGGCACCTCGCCCGCTGTTTACCGCTGCCCGGGAAGTGAAAACGGTTGTTCCGGT
CAGTTCAGTTACGCCGGTAACACCTCCTCGTCCGCTAAGAACGGGTGAGCAGACGGCAGCATTATGGATA
GCGCCTTATATTGATAACCAGGATGTTTATCATCAGCCATCCAGCGTGTTTTTTGTTATTAAACCGTCTG
CGTGGGGAAAACCACGTATTAATTAA
 Primer design