SecReT4
Protein ID: 253801037
T4SS name [ID]Tra_F [109]
Gene symboltraC
Locus tagpVir_64
StrainEscherichia coli Vir68 plasmid pVir68 (NC_012944)
Repliconplasmid pVir68 [GenBank: NC_012944] [Browse all T4SS(s) in this replicon]
Location [Strand]64121..66748 [+]
Productconjugal transfer ATP-binding protein TraC
Component typeTraC_F
UniProt IDC5ZZK7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 4.5e-59, Aligned region: 37..277
AAA_10 [PF12846], Evalue: 1.7e-43, Aligned region: 479..772
DUF87 [PF01935], Evalue: 1.6e-05, Aligned region: 482..669
TrwB_AAD_bind [PF10412], Evalue: 5.5e-05, Aligned region: 479..517
Protein Sequence: 875 a.a.     [Download]
>gi|253801037|ref|YP_003034038.1| conjugal transfer ATP-binding protein TraC [Escherichia coli Vir68]
MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAIP
INGANESIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAAA
TQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASITTQTVDAQAFIDIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFL
WNVADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAESPTIRSRLDEMIVLLDQYT
ANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGWR
LLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGL
SIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA
 
Nucleotide Sequence: 2628 bp     [Download]
>gi|253800975|ref|NC_012944.1|:64121-66748 Escherichia coli Vir68 plasmid pVir68, complete sequence
GTGAATAACCCACTTGAGGCCGTCACTCAGGCGGTTAACTCCCTCGTCACAGCACTGAAACTGCCTGACG
AATCCGCAAAGGCCAATGAAGTTCTGGGCGAAATGAGCTTCCCGCAGTTCAGCCGTCTGCTGCCGTACCG
TGATTACAACCAGGAATCCGGTCTGTTCATGAATGACACCACGATGGGCTTTATGCTGGAAGCCATCCCC
ATCAATGGGGCGAATGAGTCCATTGTGGAGGCCCTCGATCACATGCTGCGCACCAAACTGCCGCGCGGTA
TTCCGTTGTGTATCCATCTGATGTCCAGTCAGCTGGTTGGTGACAGGATTGAATACGGGCTGCGTGAGTT
CTCCTGGTCAGGTGAACAGGCTGAACGGTTTAACGCCATTACCCGGGCCTATTATATGAAAGCGGCAGCG
ACACAGTTTCCGCTGCCGGAGGGGATGAATCTGCCCCTGACCCTGCGCCATTACCGGGTGTTTATCTCGT
ACTGTTCTCCTTCGAAGAAAAAAAGCCGGGCCGACATTCTGGAAATGGAAAACCTGGTGAAAATCATCCG
GGCGTCGTTACAGGGGGCCAGTATCACCACACAGACGGTGGATGCACAGGCCTTTATCGATATTGTCGGG
GAGATGATTAACCATAACCCGGACTCCCTGTACCCGAAAAGACGTCAGCTGGACCCGTATTCTGATCTGA
ATTATCAGTGTGTGGAGGACAGTTTTGATCTGAAAGTCCGGGCTGATTACCTGACGCTGGGCCTGCGTGA
GAACGGCAGGAACAGCACGGCCCGCATCCTGAATTTCCATCTGGCCCGTAACCCGGAAATCGCCTTCCTG
TGGAACGTGGCCGACAACTACAGCAACCTGCTGAACCCGGAACTGTCCATCTCCTGTCCGTTCATCCTGA
CGCTGACTCTGGTGGTGGAAGACCAGGTGAAAACCCACAGCGAAGCCAACCTGAAGTACATGGACCTGGA
GAAAAAGTCGAAGACCTCCTATGCCAAATGGTTTCCGTCCGTGGAGAAAGAGGCGAAGGAGTGGGGGGAA
CTGCGTCAGCGGCTGGGCTCCGGTCAGTCCTCCGTGGTGTCCTACTTCCTCAACATCACAGCATTCTGCA
AGGACAATAATGAAACGGCGCTGGAAGTGGAGCAGGACATCCTGAACAGCTTTCGTAAAAACGGTTTTGA
GCTGATTTCACCGCGCTTTAACCACATGCGCAATTTCCTGACCTGCCTGCCCTTTATGGCCGGGAAAGGG
CTGTTTAAACAGTTGAAAGAGGCCGGAGTGGTTCAGCGCGCAGAGAGCTTTAATGTTGCCAACCTGATGC
CGTTAGTGGCGGATAACCCCCTGACACCGGCAGGTCTGCTGGCACCCACCTACCGTAACCAGCTGGCGTT
TATCGATATTTTCTTCCGGGGGATGAATAACACCAACTACAACATGGCGGTCTGTGGCACCTCCGGGGCC
GGTAAAACCGGGCTGATACAGCCACTTATCCGCAGCGTGCTGGACTCCGGAGGCTTTGCCGTGGTGTTCG
ACATGGGGGATGGATACAAGTCCCTGTGTGAGAACATGGGCGGGGTGTATCTGGACGGTGAAACCCTGCG
TTTTAACCCGTTTGCGAACATCACCGATATTGACCAGTCAGCGGAGCGTGTCCGTGACCAGTTGTCAGTG
ATGGCCAGCCCCAACGGTAACCTGGATGAAGTGCATGAAGGTCTGCTGTTGCAGGCGGTCAGAGCCTCCT
GGCTGGCCAAAGAGAACAGAGCACGTATTGATGACGTGGTGGATTTCCTGAAAAACGCCAGTGACAGCGA
GCAGTATGCCGAGTCACCGACTATCCGCAGCCGTCTGGACGAAATGATTGTGCTGCTTGACCAGTACACT
GCCAACGGCACTTACGGCCAGTATTTTAACTCTGATGAGCCGTCCCTGCGGGATGACGCAAAAATGGTGG
TGCTGGAGCTGGGCGGACTGGAAGACCGTCCGTCACTGCTGGTTGCGGTGATGTTCTCCCTGATTATCTA
CATCGAGAACAGGATGTACCGCACGCCGCGTAACCTCAAGAAACTGAACGTTATTGATGAAGGCTGGCGT
CTGCTGGACTTCAAAAATCACAAGGTCGGTGAATTTATTGAGAAAGGCTACCGTACGGCCCGCCGTCATA
CCGGTGCCTATATCACCATCACACAGAACATCGTCGACTTTGACTCTGATAAGGCCTCCAGTGCTGCCCG
CGCGGCATGGGGTAACTCCTCCTACAAAATTATCCTCAAACAGAGTGCGAAGGAGTTCGCGAAATACAAC
CAACTGTATCCGGACCAGTTCCTGCCACTGCAGCGCGACATGATTGGTAAGTTTGGTGCGGCCAAAGACC
AGTGGTTCAGTTCCTTCCTGCTGCAGGTGGAAAACCATTCCTCCTGGCACCGTCTGTTTGTGGACCCGTT
AAGCCGCGCCATGTACAGCTCTGACGGCCCGGATTTTGAGTTTGTGCAGCAGAAGCGTAAAGAGGGGCTG
AGTATTCATGAGGCAGTGTGGCAGCTGGCGTGGAAGAAGTCAGGGCCGGAAATGGCTTCGCTGGAAGCCT
GGCTGGAAGAACATGAGAAATACAGGAGTGTGGCATGA
 Primer design