SecReT4
Protein ID: 253801039
T4SS name [ID]Tra_F [109]
Gene symboltraW
Locus tagpVir_66
StrainEscherichia coli Vir68 plasmid pVir68 (NC_012944)
Repliconplasmid pVir68 [GenBank: NC_012944] [Browse all T4SS(s) in this replicon]
Location [Strand]67128..67760 [+]
Productconjugal transfer pilus assembly protein TraW
Component typeTraW_F
UniProt IDC5ZZK9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraW_N [PF12477], Evalue: 7.6e-11, Aligned region: 1..30
Protein Sequence: 210 a.a.     [Download]
>gi|253801039|ref|YP_003034040.1| conjugal transfer pilus assembly protein TraW [Escherichia coli Vir68]
MRCRGLIALLIWGQSVAAADLGTWGDLWPVKEPDMLTVIMQRLTALEQSGEMGRKMDAFKERVIRNSLRP
PAVPGIGRTEKYGSRLFDPSVRLAADIRDNEGRVFARQGEVMNPLQYVPFNQTLYFINGDDPAQVAWMKR
QTPPTLESKIILVQGSIPEMQKSLDSRVYFDQNGVLCQRLGIDQVPARVSAVPGDRFLKVEFIPAEEGRK
 
Nucleotide Sequence: 633 bp     [Download]
>gi|253800975|ref|NC_012944.1|:67128-67760 Escherichia coli Vir68 plasmid pVir68, complete sequence
ATGAGATGCCGGGGGCTGATTGCCCTGCTGATATGGGGGCAGAGTGTGGCCGCCGCCGATCTTGGTACCT
GGGGCGATCTGTGGCCGGTAAAGGAGCCGGACATGCTGACGGTGATCATGCAGCGCCTGACGGCACTGGA
GCAGTCCGGTGAGATGGGCCGGAAAATGGATGCCTTTAAGGAGCGGGTGATCCGCAACAGTCTGCGGCCC
CCTGCCGTGCCCGGTATCGGACGCACGGAGAAATACGGCAGCCGGTTGTTTGACCCGTCCGTCAGACTGG
CTGCGGATATCCGGGATAACGAAGGGCGGGTGTTTGCCCGTCAGGGTGAAGTGATGAATCCGCTGCAGTA
TGTTCCTTTTAACCAGACGCTGTATTTCATCAATGGCGATGATCCGGCGCAGGTGGCCTGGATGAAACGC
CAGACGCCGCCCACACTGGAGAGCAAAATTATCCTCGTGCAGGGCAGTATCCCGGAGATGCAGAAGTCTC
TGGACAGCCGTGTTTACTTTGACCAGAACGGTGTGCTCTGCCAGCGCCTCGGCATTGATCAGGTCCCGGC
ACGGGTGAGCGCCGTTCCCGGCGATCGCTTCCTGAAGGTGGAATTTATTCCGGCAGAGGAGGGCAGAAAA
TGA
 Primer design