SecReT4
Protein ID: 253801040
T4SS name [ID]Tra_F [109]
Gene symboltraU
Locus tagpVir_67
StrainEscherichia coli Vir68 plasmid pVir68 (NC_012944)
Repliconplasmid pVir68 [GenBank: NC_012944] [Browse all T4SS(s) in this replicon]
Location [Strand]67757..68749 [+]
Productconjugal transfer pilus assembly protein TraU
Component typeTraU_F
UniProt IDC5ZZL0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 2.4e-84, Aligned region: 29..329
Protein Sequence: 330 a.a.     [Download]
>gi|253801040|ref|YP_003034041.1| conjugal transfer pilus assembly protein TraU [Escherichia coli Vir68]
MKRRLWLLMLFLFAGHVPAASADSACEGRFVNPITDICWSCIFPLSLGSIKVSQGKVPDTANPSMPIQIC
PAPPPLFRRIGLAIGYWEPMALTDVTRSPGCMVNLGFSLPAFGKTAQGTAKKDEKQVNGAFYHVHWYKYP
LTYWLNIITSLGCLEGGDLDIAYLSEIDPTWTDSSLTTILNPEAVIFANPIAQGACAADAIASAFNMPLD
VLFWCAGSQGSMYPFNGWVSNESSPLQSSLLVSERMAFKLHRQGMIMETIGKNNAVCNEYPSPILPKERW
RYQMVNMYPDSGQCHPFGRSVTRWETGKNPPNTKKNFGYLMWRKRNCVFL
 
Nucleotide Sequence: 993 bp     [Download]
>gi|253800975|ref|NC_012944.1|:67757-68749 Escherichia coli Vir68 plasmid pVir68, complete sequence
ATGAAGCGAAGGCTGTGGCTGCTGATGTTATTCCTTTTCGCCGGTCATGTCCCTGCGGCGTCTGCGGATT
CTGCCTGTGAGGGGCGTTTTGTAAACCCGATCACAGATATCTGCTGGAGCTGTATTTTCCCGCTCTCGCT
GGGCAGTATCAAAGTCAGTCAGGGTAAGGTCCCCGACACGGCGAACCCGTCGATGCCCATTCAGATTTGT
CCGGCACCGCCGCCGCTGTTCAGGCGTATCGGGCTGGCCATTGGTTACTGGGAGCCGATGGCGTTGACGG
ACGTCACCCGGTCACCGGGATGCATGGTGAACCTGGGCTTCAGCCTGCCGGCTTTTGGTAAAACGGCACA
GGGAACGGCGAAAAAGGATGAGAAGCAGGTAAATGGGGCGTTCTATCACGTTCACTGGTACAAATACCCG
CTGACGTACTGGCTGAACATCATCACATCGCTGGGCTGTCTGGAAGGTGGTGACCTGGATATCGCTTATC
TTTCTGAAATCGACCCCACCTGGACGGACAGCAGCCTGACCACCATTCTCAATCCGGAAGCTGTCATCTT
TGCCAATCCGATAGCACAGGGAGCCTGCGCAGCAGATGCGATTGCCAGCGCCTTTAATATGCCTCTCGAT
GTTCTGTTCTGGTGTGCCGGTTCGCAGGGAAGTATGTACCCGTTCAATGGCTGGGTGAGTAATGAGTCCA
GTCCGTTGCAGTCCTCCCTGCTGGTCAGTGAACGCATGGCGTTCAAGCTGCACCGTCAGGGCATGATTAT
GGAAACCATCGGGAAAAATAACGCCGTCTGTAATGAATATCCGTCCCCAATCCTGCCCAAAGAACGCTGG
CGTTACCAGATGGTGAATATGTATCCGGACAGCGGGCAGTGCCACCCGTTCGGGCGCAGCGTGACCCGCT
GGGAAACCGGGAAAAATCCGCCCAACACAAAGAAAAACTTCGGCTACCTGATGTGGCGTAAACGTAACTG
TGTCTTCCTGTGA
 Primer design