SecReT4
Protein ID: 253801041
T4SS name [ID]Tra_F [109]
Gene symboltrbC
Locus tagpVir_68
StrainEscherichia coli Vir68 plasmid pVir68 (NC_012944)
Repliconplasmid pVir68 [GenBank: NC_012944] [Browse all T4SS(s) in this replicon]
Location [Strand]68755..69396 [+]
Productconjugal transfer pilus assembly protein TrbC
Component typeTrbC_F
UniProt IDC5ZZL1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 7.2e-28, Aligned region: 94..192
Protein Sequence: 213 a.a.     [Download]
>gi|253801041|ref|YP_003034042.1| conjugal transfer pilus assembly protein TrbC [Escherichia coli Vir68]
MMKLSMKSLAALLMMLNGAVMASENVNTPENRQFLKQQENLSRQLREKPDHQLKAWAEKQVLEKPLQRSD
NHFLDELVRKQQASQDGKPRQGALYFVSFSIPEEGLKRMLGETRHYGIPATLRGMVNNDLKTTAEAVLSL
VKDGATDGVQIDPTLFSQYGIRTVPALVVFCSQGYDIIRGNLRVGQALEKVAATGDCRQVAHDLLAGKGD
SGK
 
Nucleotide Sequence: 642 bp     [Download]
>gi|253800975|ref|NC_012944.1|:68755-69396 Escherichia coli Vir68 plasmid pVir68, complete sequence
ATGATGAAGCTGAGTATGAAATCTCTGGCAGCACTGCTGATGATGCTGAACGGGGCGGTTATGGCGTCAG
AAAACGTGAACACTCCTGAAAACCGCCAGTTCCTGAAGCAGCAGGAAAATTTAAGCAGACAACTGCGTGA
AAAACCTGACCATCAGCTGAAAGCCTGGGCGGAGAAACAGGTGCTGGAAAAACCCCTTCAGCGTTCAGAT
AACCATTTCCTGGATGAGCTGGTTCGTAAACAGCAGGCTTCGCAGGACGGGAAACCCCGGCAGGGTGCTC
TGTATTTTGTGTCGTTTTCCATTCCCGAAGAGGGGCTGAAACGAATGCTGGGCGAAACCCGGCACTACGG
TATTCCGGCCACACTGCGGGGCATGGTGAACAATGACCTGAAGACCACCGCTGAAGCTGTGTTGTCCCTG
GTGAAAGACGGCGCGACTGATGGTGTTCAGATCGACCCGACGCTGTTTTCACAGTACGGCATTCGCACTG
TACCGGCACTGGTGGTGTTCTGCAGTCAGGGATACGACATCATCCGGGGAAACCTGCGGGTCGGCCAGGC
GCTGGAGAAAGTGGCCGCCACGGGTGACTGCCGGCAGGTGGCTCATGATTTACTGGCAGGGAAAGGAGAT
TCCGGGAAATGA
 Primer design