SecReT4
Protein ID: 253801042
T4SS name [ID]Tra_F [109]
Gene symboltraN
Locus tagpVir_69
StrainEscherichia coli Vir68 plasmid pVir68 (NC_012944)
Repliconplasmid pVir68 [GenBank: NC_012944] [Browse all T4SS(s) in this replicon]
Location [Strand]69393..71201 [+]
Productconjugal transfer mating pair stabilization protein TraN
Component typeTraN_F
UniProt IDC5ZZL2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 3.2e-74, Aligned region: 306..552
Protein Sequence: 602 a.a.     [Download]
>gi|253801042|ref|YP_003034043.1| conjugal transfer mating pair stabilization protein TraN [Escherichia coli Vir68]
MKRILPLILALVAGMAQADSNSDYRAGSDFAHQIKGQGSSSIQGFKPQESIPGYNANPDETKYYGGVTAG
GDGGLKNDGTTEWATGETGKTITESFMNKPKDILSPDASFIQTGRDVVNRADSIVGNTGQQCSAQEISRS
EYTNYTCERDLQVEQYCTRTARMELQGSTTWETRTLEYEMSQLPAREVNGQYVVSITSPVTGEIVDAHYS
WSRTYLQKSVPMTITVLGTPLSWNAKYSADASFTPVQKTLTAGVAFTSSHPVRVGNTKFKRHTAMKLRLV
VRVKKASYTPYVVWSESCPFSKELGKLTKTECTEAGGNRTLVKDGQSYSMYQSCWAYRDTYVTQSADKGT
CQTYTDNPACTLVSHQCAFYSEEGACLHEYATYSCESKTSGKVMVCGGDVFCLDGECDKAQSGQSNDFAE
AVSQLAALAAAGKDVAALNGVDVRAFTGQAKFCKKAAAGYSNCCKDSGWGQDIGLAKCSSDEKALAKAKS
NKLTVSVGEFCSKKVLGVCLEKKRSYCQFDSKLAQIVQQQGRNGQLRISFGSAKHPDCRGITVDELQKIQ
FNRLDFTNFYEDLMNNQKIPDSGVLTQKVKEQIADQLKQAGQ
 
Nucleotide Sequence: 1809 bp     [Download]
>gi|253800975|ref|NC_012944.1|:69393-71201 Escherichia coli Vir68 plasmid pVir68, complete sequence
ATGAAACGTATTTTACCTCTGATACTGGCTCTGGTTGCCGGCATGGCACAGGCTGACAGCAACAGTGATT
ACCGGGCCGGTTCTGATTTTGCTCACCAGATCAAAGGGCAGGGAAGCAGCAGTATTCAGGGCTTTAAGCC
ACAGGAGAGTATCCCCGGCTATAACGCGAATCCGGACGAGACAAAATATTACGGTGGCGTGACTGCCGGC
GGGGATGGCGGCCTGAAAAATGACGGCACCACGGAATGGGCGACCGGTGAAACCGGAAAAACCATTACAG
AGTCATTCATGAACAAGCCGAAAGACATTCTTTCACCGGATGCATCGTTTATCCAGACCGGCAGGGATGT
GGTGAACCGGGCTGACAGCATTGTGGGAAACACCGGGCAGCAGTGCAGTGCGCAGGAGATTAGCAGGAGT
GAATACACGAATTACACCTGTGAGCGGGATTTACAGGTGGAGCAGTACTGCACACGAACTGCCCGTATGG
AGCTGCAGGGGAGTACCACATGGGAAACCCGGACGCTGGAGTATGAAATGAGTCAGCTACCTGCACGTGA
AGTGAATGGTCAGTATGTTGTCTCCATTACCTCTCCCGTTACCGGTGAAATTGTCGATGCGCATTACAGC
TGGAGTCGTACTTACCTGCAGAAGAGTGTACCTATGACAATTACAGTACTGGGAACCCCACTGAGCTGGA
ATGCCAAATACTCAGCAGATGCCTCATTTACACCAGTACAGAAAACACTGACTGCCGGTGTGGCTTTTAC
GTCATCTCACCCCGTCCGGGTCGGGAATACAAAATTCAAACGTCATACGGCAATGAAGCTGCGTCTGGTT
GTCAGGGTAAAAAAAGCCTCGTACACCCCGTATGTTGTCTGGTCTGAAAGCTGCCCGTTCAGCAAGGAGC
TGGGGAAACTGACAAAAACAGAATGTACGGAGGCTGGCGGGAACAGGACGCTGGTGAAAGACGGTCAGTC
ATACAGCATGTACCAGAGCTGCTGGGCATACCGGGACACGTATGTCACGCAGTCAGCAGACAAGGGAACC
TGTCAGACCTACACCGACAATCCTGCCTGTACCCTGGTGTCACACCAGTGTGCCTTTTACTCCGAAGAAG
GTGCCTGTCTGCATGAATATGCCACGTACTCCTGTGAGTCAAAAACATCCGGGAAAGTGATGGTCTGTGG
GGGAGACGTCTTCTGTCTCGATGGCGAATGCGATAAGGCTCAGAGCGGGCAGAGTAATGATTTTGCCGAA
GCCGTCTCTCAGCTGGCGGCACTGGCCGCAGCAGGTAAGGATGTTGCGGCGCTGAACGGGGTGGATGTCC
GTGCTTTCACCGGTCAGGCGAAATTTTGTAAGAAGGCTGCAGCCGGATACAGCAACTGCTGTAAGGACAG
CGGCTGGGGACAGGATATCGGGCTGGCCAAATGCAGCAGTGATGAAAAGGCCCTGGCTAAAGCAAAATCA
AACAAACTGACCGTCAGCGTCGGGGAGTTCTGTTCGAAGAAAGTGCTGGGTGTCTGTCTGGAGAAAAAAC
GCAGCTACTGTCAGTTTGATTCGAAGCTGGCGCAGATAGTCCAGCAGCAGGGGCGCAACGGTCAGTTGCG
TATCAGTTTTGGTAGTGCGAAGCATCCTGACTGTCGGGGGATTACGGTTGATGAGCTGCAGAAAATTCAG
TTCAACAGACTGGATTTCACTAACTTCTACGAAGACCTGATGAATAACCAGAAAATCCCGGACAGTGGCG
TTCTGACGCAGAAAGTGAAAGAGCAGATTGCTGACCAGCTGAAACAGGCAGGACAGTAA
 Primer design