SecReT4
Protein ID: 253801044
T4SS name [ID]Tra_F [109]
Gene symboltraF
Locus tagpVir_71
StrainEscherichia coli Vir68 plasmid pVir68 (NC_012944)
Repliconplasmid pVir68 [GenBank: NC_012944] [Browse all T4SS(s) in this replicon]
Location [Strand]71448..72221 [+]
Productconjugal pilus assembly protein TraF
Component typeTraF_F
UniProt IDC5ZZL4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 9.2e-79, Aligned region: 33..247
Protein Sequence: 257 a.a.     [Download]
>gi|253801044|ref|YP_003034045.1| conjugal pilus assembly protein TraF [Escherichia coli Vir68]
MKEKVMKGMKMNKALLPLLLCCFIFPASGKDAGWQWYNEKINPKEKENKPVPAAPRQEPDIMQKLAALQT
ATKRALYEAILYPGVDNFVKYFRLQNYWTQQAGLFTMSARKAMLAHPELDYNLQYSHYNGTVRNQLAADQ
AQQRQAIAKLAEHYGIMFFYRGQDPIDGQLAQVINGFRDTYGLSVIPVSVDGVINPLLPDSRTDQGQAQR
LGVKYFPAMMLVDPKQGSIRPLSYGFISQDDLAKQFLNVSEDFKPNF
 
Nucleotide Sequence: 774 bp     [Download]
>gi|253800975|ref|NC_012944.1|:71448-72221 Escherichia coli Vir68 plasmid pVir68, complete sequence
ATGAAAGAAAAAGTGATGAAAGGAATGAAGATGAATAAAGCATTACTGCCACTGTTACTCTGCTGCTTTA
TTTTTCCGGCGTCAGGAAAAGATGCAGGCTGGCAGTGGTATAACGAGAAAATAAATCCGAAGGAAAAAGA
AAATAAACCTGTACCTGCAGCCCCCCGTCAGGAACCGGATATTATGCAGAAACTGGCCGCACTGCAGACG
GCAACAAAGCGGGCGCTGTACGAAGCCATTCTGTATCCCGGCGTGGATAATTTTGTGAAATATTTCCGGC
TGCAAAATTACTGGACTCAGCAGGCCGGGCTTTTCACCATGAGCGCCAGAAAGGCCATGCTGGCACATCC
TGAACTGGACTATAACCTGCAGTACAGCCATTACAACGGCACGGTACGGAACCAGCTGGCAGCAGACCAG
GCGCAGCAGCGACAGGCCATTGCGAAACTGGCTGAACACTACGGCATCATGTTTTTTTACCGGGGGCAGG
ACCCCATCGACGGGCAACTGGCGCAGGTCATTAATGGCTTCCGGGATACGTATGGTCTGAGTGTTATTCC
CGTTTCCGTGGATGGCGTGATTAATCCGCTGTTGCCGGATTCCCGGACTGACCAGGGGCAGGCGCAGCGC
CTCGGCGTGAAATATTTCCCGGCCATGATGCTGGTTGACCCGAAACAGGGCAGTATTCGCCCGTTATCAT
ACGGCTTTATTTCGCAGGACGACCTGGCAAAACAGTTCCTGAACGTTTCTGAAGATTTTAAACCCAATTT
TTAA
 Primer design