SecReT4
Protein ID: 253801047
T4SS name [ID]Tra_F [109]
Gene symboltraQ
Locus tagpVir_73
StrainEscherichia coli Vir68 plasmid pVir68 (NC_012944)
Repliconplasmid pVir68 [GenBank: NC_012944] [Browse all T4SS(s) in this replicon]
Location [Strand]72981..73265 [+]
Productconjugal transfer pilin chaperone TraQ
Component typeTraQ_F
UniProt IDC5ZZL7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 1.2e-50, Aligned region: 2..94
Protein Sequence: 94 a.a.     [Download]
>gi|253801047|ref|YP_003034048.1| conjugal transfer pilin chaperone TraQ [Escherichia coli Vir68]
MISKRRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYQVLDAWIARVSRE
EREALEARQQAMMEGQQEGGHVSH
 
Nucleotide Sequence: 285 bp     [Download]
>gi|253800975|ref|NC_012944.1|:72981-73265 Escherichia coli Vir68 plasmid pVir68, complete sequence
ATGATAAGTAAACGCAGATTCTCTTTACCCCGGCTTGATATTACGGGAATGTGGGTATTTTCCCTGGGTG
TCTGGTTTCATATCGTCGCCCGTCTTGTTTACAGCAAACCCTGGATGGCTTTTTTTCTGGCGGAGCTGAT
TGCGGCCATTCTCGTACTGTTCGGCGCATACCAGGTGCTGGATGCATGGATTGCCCGTGTCAGCCGGGAA
GAGCGTGAGGCACTGGAAGCCAGGCAACAGGCCATGATGGAAGGGCAGCAGGAGGGCGGACATGTCTCTC
ACTAA
 Primer design