SecReT4
Protein ID: 253801051
T4SS name [ID]Tra_F [109]
Gene symboltraH
Locus tagpVir_77
StrainEscherichia coli Vir68 plasmid pVir68 (NC_012944)
Repliconplasmid pVir68 [GenBank: NC_012944] [Browse all T4SS(s) in this replicon]
Location [Strand]74432..75808 [+]
Productconjugal transfer pilus assembly protein TraH
Component typeTraH_F
UniProt IDC5ZZM1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 1.5e-116, Aligned region: 30..379
Protein Sequence: 458 a.a.     [Download]
>gi|253801051|ref|YP_003034052.1| conjugal transfer pilus assembly protein TraH [Escherichia coli Vir68]
MMPRIKPLLVLCAALLTVTPAASADVNSDMNQFFNKLGFASNTTQPGVWQGQAAGYAYGGSLYARTQVKN
VQLISMTLPDINAGCGGIDAYLGSFSFINGEQLQRFVKQIMSNAAGYFFDLALQTTVPEIKTAKDFVQKM
ASDINSMNLSSCQAAQGIIGGLFPRTQVSQQKVCQDIAGESNIFADWAASRQGCTVGGKSDSVRDKASDK
DKERVTKNINIMWNALSKNRMFDGNKELKEFVMTLTGSLVFGPNGEITPLSARTTDRSIIRAMMEGGTAK
IYHCNDSDKCLKVVADTPVTISRDNALKSQITKLLASIQNKAVSDTPLDDKEKGFISSTTIPVFKYLVDP
QMLGVSNSMIYQLTDYIGYDILLQYIQELIQQARAMVATGNYDEAVIGHINDNMNDATRQIAAFQSQVQV
QQDALLVVDRQMSYMRQQLSARMLSRYQNNYHFGGSTR
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|253800975|ref|NC_012944.1|:74432-75808 Escherichia coli Vir68 plasmid pVir68, complete sequence
ATGATGCCACGCATTAAACCTCTTCTGGTTCTTTGTGCCGCCTTACTGACGGTGACGCCTGCAGCGTCAG
CGGATGTGAACAGCGACATGAATCAGTTCTTTAATAAGCTGGGATTTGCTTCCAATACCACACAGCCGGG
CGTCTGGCAGGGGCAGGCCGCCGGCTATGCTTACGGTGGCTCCCTGTATGCCCGTACTCAGGTCAAAAAT
GTTCAGCTAATTTCCATGACGCTGCCGGATATCAATGCTGGATGTGGCGGCATCGACGCCTATCTCGGCT
CGTTCAGTTTTATTAATGGTGAGCAGTTGCAGCGTTTTGTTAAGCAGATTATGAGCAATGCTGCCGGTTA
CTTTTTTGACCTTGCCCTGCAGACAACGGTGCCGGAAATAAAAACCGCAAAAGACTTCGTGCAGAAAATG
GCAAGCGACATTAACAGTATGAACCTCAGTTCCTGCCAGGCTGCACAGGGGATTATCGGCGGGCTTTTCC
CCCGGACGCAGGTGTCCCAGCAGAAAGTCTGTCAGGACATTGCCGGTGAGAGCAATATTTTTGCTGACTG
GGCGGCTTCCCGGCAGGGATGTACCGTTGGCGGGAAATCTGACAGTGTCAGGGATAAAGCCAGCGACAAG
GATAAGGAGCGGGTGACCAAAAACATCAACATCATGTGGAATGCGCTTTCCAAAAACAGAATGTTTGACG
GCAACAAAGAGCTGAAAGAATTTGTGATGACGCTGACCGGCTCACTGGTGTTTGGTCCCAACGGCGAAAT
CACACCGCTGTCAGCCAGAACCACTGACCGCTCAATTATCCGGGCCATGATGGAAGGCGGCACAGCAAAA
ATTTATCACTGCAACGATTCTGATAAATGCCTGAAAGTGGTGGCAGACACACCGGTGACTATCAGCCGGG
ATAATGCACTGAAGTCTCAGATTACTAAACTTCTGGCCAGCATTCAGAACAAGGCGGTCAGTGACACGCC
TCTGGATGACAAGGAAAAAGGCTTTATTTCCAGTACCACCATCCCCGTCTTCAAATACCTGGTTGACCCG
CAGATGCTCGGAGTTTCCAACAGCATGATTTACCAGCTGACGGACTATATCGGTTACGACATCCTGCTGC
AGTACATTCAGGAGCTGATACAGCAGGCCCGGGCGATGGTGGCCACGGGAAATTATGACGAAGCGGTTAT
CGGACATATTAACGACAACATGAATGATGCCACCCGGCAGATTGCGGCGTTTCAGTCACAGGTGCAGGTA
CAGCAGGATGCGCTGCTGGTTGTCGATCGTCAGATGAGCTACATGCGTCAGCAGCTTTCCGCCCGCATGC
TCAGTCGTTACCAAAACAACTATCACTTCGGAGGGAGCACGCGGTGA
 Primer design