SecReT4
Protein ID: 253801052
T4SS name [ID]Tra_F [109]
Gene symboltraG
Locus tagpVir_78
StrainEscherichia coli Vir68 plasmid pVir68 (NC_012944)
Repliconplasmid pVir68 [GenBank: NC_012944] [Browse all T4SS(s) in this replicon]
Location [Strand]75805..78627 [+]
Productconjugal transfer mating pair stabilization protein TraG
Component typeTraG_F
UniProt IDC5ZZM2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 3.3e-127, Aligned region: 3..450
Protein Sequence: 940 a.a.     [Download]
>gi|253801052|ref|YP_003034053.1| conjugal transfer mating pair stabilization protein TraG [Escherichia coli Vir68]
MNEVYVIAGGEWLRNNLNAIAAFMGTRTWDSIEKIALTLSVLAVAVMWVQRHNVMDLLGWVAVFVLISLL
VNVRTSVQIIDNSDLVKVHRVDNVPVGLAMPLSLTTRIGHAMVASYEMIFTQPDSVTYSKTGMLFGAELV
SKSTDFLSRNPEIANLFQDYVQNCVMGDIYLNHKYTLEELMASADPYTLIFSRPSPLRGVYDSNNNFVTC
KDASVSLKDKLNLDTQSGGKTWHYYAQQLFGGRPDPNLLFSTLIGDSYSYFYGSSKSASQIIRQNVTINA
LKEGITSYAARNGDSASLVNLATTSSMEKQRLAHVSIGHVAMRTLPMTQTILTGIAIGIFPLLVLAAVFN
KLTLSVLKGYVFALMWLQSWPLLYAILNSAMTFYAKQNGAPVVLSEISQIQLKYSDLASTAGYLSMMIPP
LSWMMVRGLGAGFSSVYSHFASSAISPTASAAGSVVDGNYSYGNMQTENVNGFSWSTNSTTSFGQMMYQT
GSGATATQTRDGNMVMDASGAMSRLPVGINATRQIAVAQQEMAREASNRAESALHGFSSSIASAWNTLSQ
FGSNRGSSDSVTSGADSTMSAQDSMMASRMRSAVESYAKAHNISNEQATQELASRSTRASAGMYGDAHAE
WGVKPKILGVGGGLGVRGGGRAGIDWSDDDAHQASSGSRASYDARHDIDAKASKDFKEASDYFTSRKVSE
SGSHTDNNADSRVDQLSAALNSAKQSYDQYTTNMTRSHEYAEMASRTESMSGQMSEDLSQQFAQYVMKHA
PQDAEAILTNTSSPEIAERRRAMAWSFVQEQIQPGVDNAWRESRGDIGKGMESVPSGGGSQDIIADHQGH
QAIIEQRTQDSNIRNDVKHQVDNMVTEYKGNIGDTQNSIRGEENIVRGQYSELQNHHKTEALSQNNKYNE
EKSAQERMPGADSPQELMKRAKEYQDKYKQ
 
Nucleotide Sequence: 2823 bp     [Download]
>gi|253800975|ref|NC_012944.1|:75805-78627 Escherichia coli Vir68 plasmid pVir68, complete sequence
GTGAATGAAGTTTATGTGATTGCCGGTGGTGAGTGGTTGCGGAATAACCTGAACGCCATTGCCGCCTTTA
TGGGAACCAGGACGTGGGATTCCATTGAAAAAATTGCGCTCACATTGTCTGTTCTCGCGGTGGCCGTAAT
GTGGGTACAGCGGCACAACGTGATGGATTTGCTGGGCTGGGTGGCCGTATTTGTGCTTATCAGCCTGCTG
GTTAATGTCCGCACATCGGTGCAGATTATTGATAACAGTGACCTGGTCAAAGTTCACCGGGTGGATAATG
TGCCGGTCGGACTGGCGATGCCACTTTCACTGACGACCCGTATCGGGCATGCAATGGTGGCCAGTTACGA
GATGATCTTCACGCAACCGGACAGTGTCACCTACAGCAAAACGGGGATGCTGTTTGGCGCAGAACTGGTA
TCAAAAAGCACCGACTTTTTGTCCCGCAATCCGGAAATCGCCAATCTTTTCCAGGATTATGTGCAGAACT
GTGTTATGGGGGATATTTACCTGAACCACAAATACACGCTGGAGGAGCTGATGGCCTCCGCTGATCCCTA
CACGCTGATTTTTTCCCGCCCCAGCCCGCTGCGGGGCGTTTATGACAGCAATAATAATTTCGTAACCTGT
AAGGACGCGTCGGTTTCGCTGAAAGACAAGCTGAATCTGGACACACAGAGTGGCGGAAAAACCTGGCATT
ATTATGCCCAGCAGCTATTTGGTGGACGCCCTGATCCTAACCTGCTGTTCAGTACGCTGATTGGCGACAG
TTACAGTTACTTCTATGGCTCAAGTAAATCAGCCAGCCAGATCATCCGCCAGAATGTCACCATCAATGCG
CTGAAGGAGGGGATCACCAGTTATGCCGCACGTAATGGTGATTCGGCCAGCCTGGTGAATCTGGCCACCA
CGTCATCGATGGAGAAACAACGTCTGGCACATGTCTCCATCGGTCATGTGGCGATGCGGACACTGCCCAT
GACGCAGACCATCCTGACGGGGATCGCCATCGGTATTTTCCCGCTCCTGGTACTGGCGGCTGTATTCAAC
AAACTGACGCTGTCTGTCCTGAAAGGTTATGTGTTTGCCCTGATGTGGCTGCAGTCATGGCCACTCTTGT
ACGCCATTCTGAACAGTGCCATGACATTTTATGCGAAACAGAATGGTGCGCCGGTGGTGCTCTCTGAAAT
TTCACAGATACAACTGAAATACTCCGATCTGGCTTCCACTGCCGGGTATCTTTCCATGATGATCCCGCCA
TTATCCTGGATGATGGTCAGGGGGCTTGGGGCCGGATTTTCCAGTGTGTACAGCCATTTCGCTTCCTCTG
CTATCAGCCCGACTGCCAGTGCGGCAGGTAGTGTGGTTGACGGTAATTACTCCTACGGCAACATGCAGAC
GGAAAACGTGAACGGCTTCAGCTGGAGCACCAACAGCACCACGTCGTTTGGTCAGATGATGTACCAGACC
GGCAGTGGCGCAACCGCCACACAGACCCGTGACGGTAATATGGTGATGGATGCAAGCGGAGCGATGTCCC
GTTTACCGGTCGGTATCAATGCAACGCGTCAGATTGCAGTGGCACAACAGGAAATGGCCCGGGAGGCGTC
GAACAGAGCAGAAAGTGCCCTGCATGGTTTCAGCAGCAGTATTGCCAGTGCCTGGAACACGCTCAGTCAG
TTTGGTTCTAACCGGGGGAGCAGTGACTCTGTCACCAGTGGTGCTGACAGTACGATGAGTGCACAGGACT
CCATGATGGCCAGCCGTATGCGCAGTGCAGTGGAAAGCTATGCGAAGGCGCATAATATCAGTAATGAGCA
GGCGACTCAGGAACTGGCATCCAGAAGTACGAGAGCTTCTGCCGGGATGTATGGAGATGCTCATGCTGAA
TGGGGGGTTAAACCTAAAATTCTTGGTGTTGGTGGAGGATTAGGCGTTAGAGGTGGTGGTCGGGCTGGCA
TTGACTGGAGTGATGATGATGCGCATCAGGCCAGCAGTGGTTCACGGGCCAGCTATGATGCTCGTCATGA
TATTGACGCTAAAGCCAGTAAGGACTTTAAAGAGGCCAGCGATTACTTTACCAGTCGCAAAGTCAGTGAA
TCCGGCAGCCATACTGACAATAATGCTGATTCCCGGGTGGATCAACTGTCTGCAGCCCTGAATTCAGCGA
AACAGAGTTACGACCAGTACACGACGAATATGACCCGCAGCCATGAATATGCTGAAATGGCATCCCGTAC
TGAAAGCATGAGTGGGCAGATGAGCGAAGATTTGTCGCAACAGTTTGCACAGTATGTGATGAAACACGCA
CCGCAGGATGCCGAAGCTATTCTGACAAATACCAGTTCGCCGGAGATTGCAGAACGCCGTCGGGCAATGG
CCTGGTCTTTTGTGCAGGAACAGATACAGCCTGGTGTTGATAATGCCTGGCGGGAATCCCGTGGCGATAT
TGGTAAAGGAATGGAGAGCGTACCTTCGGGTGGAGGCAGTCAGGATATTATTGCTGACCATCAGGGACAT
CAGGCCATTATTGAGCAAAGAACGCAGGACAGTAATATCCGTAATGATGTAAAACATCAGGTTGATAATA
TGGTCACAGAATATAAAGGGAATATAGGTGATACTCAGAACAGCATACGTGGCGAGGAAAATATTGTAAG
AGGACAGTATTCTGAACTGCAGAATCACCATAAAACAGAGGCATTATCTCAGAATAATAAATATAATGAA
GAAAAGTCGGCTCAGGAAAGAATGCCCGGGGCTGACAGTCCACAGGAACTGATGAAAAGGGCAAAGGAGT
ATCAGGATAAGTATAAGCAATAA
 Primer design