SecReT4
Protein ID: 253801055
T4SS name [ID]Tra_F [109]
Gene symboltraD
Locus tagpVir_81
StrainEscherichia coli Vir68 plasmid pVir68 (NC_012944)
Repliconplasmid pVir68 [GenBank: NC_012944] [Browse all T4SS(s) in this replicon]
Location [Strand]80156..82309 [+]
Productconjugal transfer protein TraD
Component typeTraD_F
UniProt IDC5ZZM5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 2.9e-148, Aligned region: 172..561
TraD_N [PF12615], Evalue: 5.2e-34, Aligned region: 31..129
TraG-D_C [PF12696], Evalue: 1.1e-18, Aligned region: 419..541
AAA_10 [PF12846], Evalue: 2.2e-10, Aligned region: 187..491
T4SS-DNA_transf [PF02534], Evalue: 9.4e-08, Aligned region: 382..476
Protein Sequence: 717 a.a.     [Download]
>gi|253801055|ref|YP_003034056.1| conjugal transfer protein TraD [Escherichia coli Vir68]
MSFNAKDMTQGGQIASMRIRMFSQIANIILYCLFIFFWILVGLVLWVKISWQTFVNGCIYWWCTTLEGMR
DLIRSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLASVVALVICLITFFVVSWILGRQGKQ
QSENEITGGRQLTDNPKEVARMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYAR
QRGDMVVIYDRSGEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQG
SGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEHNGEPFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAATLFDVMNTRAFFRSPSHKIA
EFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSL
KYQTRPKVAPEFIPRDINPEMENRLSAVLAAREAEGRQMASLFEPDVPEVVSGEDVTQAEQPQQPVSPAI
NDKKSDAGVNVPAGGIEQELKMKPEEEMEQQLPPGISESGEVVDMAVYEAWQREQNPDIQQKMQRREEVN
INVHRERGEDVEPGDDF
 
Nucleotide Sequence: 2154 bp     [Download]
>gi|253800975|ref|NC_012944.1|:80156-82309 Escherichia coli Vir68 plasmid pVir68, complete sequence
ATGAGTTTTAACGCAAAGGATATGACCCAGGGCGGTCAGATTGCGTCCATGCGTATCCGCATGTTCAGTC
AGATCGCCAATATCATACTTTACTGCCTGTTTATTTTTTTCTGGATCCTAGTTGGTCTGGTTTTATGGGT
AAAAATAAGCTGGCAGACGTTTGTGAATGGCTGCATTTACTGGTGGTGCACCACGCTGGAAGGCATGCGG
GATTTAATCAGGTCCCAGCCGGTCTATGAGATCCAGTATTACGGCAAAACCTTCCGGATGAACGCGGCTC
AGGTACTGCATGATAAATATATGATCTGGTGCGGTGAGCAGTTATGGTCGGCATTCGTTCTGGCGTCTGT
CGTGGCCCTGGTTATCTGCCTGATCACCTTCTTTGTTGTCTCCTGGATTCTGGGGCGTCAGGGTAAACAA
CAGAGCGAAAATGAAATCACAGGTGGTCGTCAGCTGACTGACAATCCGAAAGAGGTGGCCAGGATGCTGA
AAAAAGATGGCAAGGATTCCGATATCCGGATTGGCGATCTGCCGATTATCCGGGATTCTGAAATCCAGAA
CTTCTGTCTGCACGGCACTGTCGGGGCCGGTAAGTCGGAGGTTATCCGTCGTCTGGCCAACTACGCCCGT
CAGCGTGGTGATATGGTGGTGATTTATGACCGTTCGGGGGAATTTGTTAAAAGTTACTATGATCCCTCCA
TCGATAAAATCCTGAATCCGCTGGATGCACGCTGTGCTGCCTGGGATTTGTGGAAGGAGTGCCTGACACA
GCCAGATTTTGATAATACCGCAAATACTCTGATCCCGATGGGGACAAAAGAGGACCCGTTCTGGCAGGGT
TCAGGACGTACCATTTTTGCGGAAGCGGCATACCTGATGCGTAATGACCCCAACCGCAGCTACAGCAAAC
TGGTGGACACACTGCTTTCCATCAAAATTGAAAAGCTGCGTACCTTCCTGCGTAATTCACCGGCGGCCAA
CCTGGTGGAAGAGAAAATCGAGAAAACGGCCATATCCATCCGTGCTGTGCTGACCAACTACGTGAAAGCC
ATCCGTTACCTGCAGGGGATTGAGCATAACGGTGAGCCCTTCACCATCCGTGACTGGATGCGTGGTGTCC
GGGAAGATCAGAAAAACGGCTGGCTGTTTATTTCGTCGAACGCCGACACCCATGCCTCCCTGAAGCCGGT
GATCTCCATGTGGCTGTCCATTGCTATTCGTGGTCTGCTGGCAATGGGAGAAAACCGTAACCGTCGTGTG
TGGTTTTTCTGTGACGAGTTACCCACGTTACACAAACTGCCGGACCTGGTGGAGATCCTGCCGGAAGCCC
GTAAGTTCGGTGGCTGTTATGTGTTTGGTATCCAGTCCTATGCCCAGCTGGAAGATATCTACGGTGAGAA
AGCGGCTGCCACGCTGTTTGACGTCATGAACACCCGTGCCTTTTTCCGTTCTCCCAGCCATAAGATTGCA
GAGTTCGCTGCCGGTGAAATTGGTGAGAAAGAGCACCTGAAAGCCAGCGAGCAGTATTCCTACGGTGCTG
ATCCGGTACGTGACGGGGTATCGACCGGTAAGGATATGGAGCGTCAGACGCTGGTCAGTTATTCCGACAT
TCAGTCTCTGCCGGATCTGACCTGTTATGTCACCCTGCCCGGACCGTATCCGGCAGTAAAACTCTCCCTG
AAATATCAGACACGACCGAAGGTCGCTCCGGAGTTTATTCCGCGTGACATCAACCCGGAAATGGAGAACC
GTCTGAGTGCCGTACTTGCCGCAAGGGAAGCAGAAGGTCGTCAGATGGCCAGCCTCTTCGAACCGGATGT
CCCGGAGGTTGTTTCCGGAGAAGACGTGACTCAGGCTGAACAGCCGCAACAGCCGGTGTCTCCTGCCATC
AACGATAAGAAGTCAGATGCTGGTGTGAATGTTCCGGCAGGGGGGATCGAGCAGGAGCTGAAAATGAAAC
CGGAAGAAGAGATGGAACAGCAACTGCCACCCGGGATCAGTGAATCCGGTGAAGTGGTGGATATGGCCGT
TTATGAGGCATGGCAACGGGAGCAGAATCCGGATATCCAGCAGAAGATGCAGCGTCGTGAAGAGGTGAAC
ATCAATGTGCACCGGGAGCGCGGGGAGGATGTTGAGCCGGGAGATGATTTCTGA
 Primer design